KEGG   Methanosphaera stadtmanae: Msp_0337Help
Entry
Msp_0337          CDS       T00313                                 

Gene name
porB
Definition
(GenBank) PorB
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
mst  Methanosphaera stadtmanae
Pathway
mst00010  Glycolysis / Gluconeogenesis
mst00020  Citrate cycle (TCA cycle)
mst00620  Pyruvate metabolism
mst00640  Propanoate metabolism
mst00650  Butanoate metabolism
mst00680  Methane metabolism
mst00720  Carbon fixation pathways in prokaryotes
mst01100  Metabolic pathways
mst01120  Microbial metabolism in diverse environments
mst01130  Biosynthesis of antibiotics
mst01200  Carbon metabolism
Module
mst_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mst_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mst00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msp_0337 (porB)
   00020 Citrate cycle (TCA cycle)
    Msp_0337 (porB)
   00620 Pyruvate metabolism
    Msp_0337 (porB)
   00640 Propanoate metabolism
    Msp_0337 (porB)
   00650 Butanoate metabolism
    Msp_0337 (porB)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Msp_0337 (porB)
   00680 Methane metabolism
    Msp_0337 (porB)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Msp_0337 (porB)
Enzymes [BR:mst01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Msp_0337 (porB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: ABC56747
UniProt: Q2NHW8
Position
398254..399129
Genome map
AA seq 291 aa AA seqDB search
MKGIDEKEYLASGHRACAGCGATIAVRLALKALGQNTVAVSATGCLEVVTSPYPETSWEI
PWIHVAFENASAVASGVEEALKAQGKEDVNVLVIGGDGGTTDIGLQSLSGAMERQQNIIY
LCYDNEAYMNTGIQRSSSTPFGASTTTSPAGKVSFGEDKPKKNMAMIMAAHGIPYVATAC
VSHPYDLMEKVKKAAEVKGPAYIHVLQPCATGWGYAPKDTIKLGKLAVDTYAWILYEIDH
GKLNITVKPKEKLPIIEYLKVQKRFKHLDEKHIEAIQNFVDQQSKELGLME
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtattgacgaaaaagaatatttagcatcaggacaccgagcatgtgcaggatgt
ggtgctacaatagctgtaagattagctctaaaagcattaggtcaaaatacagttgcagtt
tcagcaacaggatgtcttgaagtagttacatcaccttatccagaaacttcttgggaaatt
ccatggatacatgtagcatttgaaaatgcttcagcagtagcaagtggtgtagaagaagca
cttaaagcacagggaaaagaagatgttaatgttcttgtaattggtggtgatggtggtaca
actgatataggtttacaatcattatctggagctatggaaagacaacaaaacataatatac
ttatgttatgataatgaagcatacatgaatactggtattcaaagaagtagttcaacacca
tttggtgcaagtacaacaacttctccagctggaaaagtaagttttggtgaagataaacct
aagaaaaacatggcaatgattatggctgctcatggaattccatatgtagcaacagcatgt
gtttctcatccatatgatttaatggaaaaagttaaaaaggctgcagaagtgaaaggacca
gcatatattcatgtattacaaccttgtgctacaggatggggttatgctcctaaagataca
attaaattaggaaaattagcagtagatacttatgcatggattctttatgaaattgatcat
ggaaaattaaatattacagttaaaccaaaagaaaaactacctataattgaatatttaaaa
gtacaaaaaagatttaaacacttagatgaaaaacatatagaagctattcaaaacttcgta
gatcaacaaagtaaagaattaggtttaatggaatga

DBGET integrated database retrieval system