KEGG   Methanosphaera stadtmanae: Msp_0986
Entry
Msp_0986          CDS       T00313                                 

Gene name
purA
Definition
(GenBank) PurA
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
mst  Methanosphaera stadtmanae
Pathway
mst00230  Purine metabolism
mst00250  Alanine, aspartate and glutamate metabolism
mst01100  Metabolic pathways
mst01240  Biosynthesis of cofactors
Module
mst_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:mst00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Msp_0986 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Msp_0986 (purA)
Enzymes [BR:mst01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     Msp_0986 (purA)
SSDB
Motif
Pfam: Adenylsucc_synt
Other DBs
NCBI-ProteinID: ABC57374
UniProt: Q2NFM9
Position
1134986..1136011
AA seq 341 aa
MTCTILVGGQWGDEGKGKCITYFCTQDKPEIIARAGVGPNAGHSVEFNGEKYGLRLTPSG
FFNKEARLLIGAGVLVNPEVFEHELEYLSKYAVEGRTFMDANCAIITDKHTKQDKDSAYL
SKKIGTTGSGCGPANADRINRTIDYAKDVPELEKYITDVPSEINKAIDEGKDVFIEGSQG
FGLSLYYGTYPYVTSKDTCASTAAADVGVGPTKVDEVIVIFKSYITRVGEGPFPTEISPE
EAEKMGIEEYGVVTGRKRRVGLFDKDFAKRSCMINGATQIALTCIDRLYPECAKVNKYED
LSQEARDYIEDIEENVGVPITIISTGPDLADTIDLRNEKLN
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgacatgtaccatattagttggtggacaatggggtgacgaaggtaaaggaaaatgtata
acatacttttgtacccaagataaacctgaaattattgctagagcaggagtaggtccaaat
gctggacactcagtagaatttaatggtgaaaaatacggtttaagattaacaccatcaggt
tttttcaataaagaagcaagattattaattggtgctggagttttagtaaatccagaagta
tttgaacacgaattagaataccttagcaaatatgcagttgaaggtagaacattcatggac
gcaaactgtgcaataatcacagacaaacacacaaaacaggataaagattcagcatattta
tctaaaaaaataggaacaactggaagtggatgtggacctgcaaatgcagatagaataaac
aggacaatagactatgcaaaagatgtaccagaactagaaaaatacattacagatgtacct
tcagaaataaacaaggcaattgatgaaggtaaagatgtatttattgaaggatcacaagga
tttggattatcattatactatggaacatacccctatgtaacaagtaaagatacatgtgca
agtactgcggcagcagatgtaggtgtaggaccaacaaaagtagatgaagtaatagtaata
tttaagtcatacattacaagagtaggtgaaggaccattcccaacagaaatttcaccagaa
gaagctgaaaaaatgggaatagaagaatatggtgtagtaacaggtcgtaaaagaagagta
ggattatttgataaagactttgcaaaaagatcatgtatgataaatggtgctacacaaata
gctctaacatgtattgatagattatatccagaatgtgctaaagtaaataaatatgaagat
ttatcacaggaagctagagattatattgaagatattgaagaaaatgttggtgttccaatt
actatcatatccacaggtcctgatcttgcagatacaattgatttaagaaatgaaaaatta
aattaa

DBGET integrated database retrieval system