KEGG   Methanosphaera stadtmanae: Msp_1062Help
Entry
Msp_1062          CDS       T00313                                 

Definition
(GenBank) predicted dehydrogenase
  KO
K17830  digeranylgeranylglycerophospholipid reductase [EC:1.3.1.101 1.3.7.11]
Organism
mst  Methanosphaera stadtmanae
Pathway
mst00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mst00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Msp_1062
Enzymes [BR:mst01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.101  2,3-bis-O-geranylgeranyl-sn-glycerol 1-phosphate reductase [NAD(P)H]
     Msp_1062
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.11  2,3-bis-O-geranylgeranyl-sn-glycero-phospholipid reductase
     Msp_1062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 DAO Trp_halogenase FAD_oxidored FAD_binding_2 HI0933_like NAD_binding_8 Pyr_redox_2 Lycopene_cycl Pyr_redox Pyr_redox_3 GIDA Thi4 AlaDh_PNT_C 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ABC57446
UniProt: Q2NFF7
Position
1203693..1204874
Genome map
AA seq 393 aa AA seqDB search
MIETDILVVGAGPSGSLAAKEAALHGADVILIDRKSEIGSPKRCAEGVSKDGLAQLGIKP
DPRWIARDLYGVRLVSPNNTSVWMDNNTIKIPEAGYILERKVFDKHMAMDAARAGAKIMI
KTNATSLKRVDDGIIVSTNHMGKDIDIHAKIVIAADGPESRIGRWAGLECNTEFKYMESC
IQFEMAGVNMENNRDIALFFGSVAPGGYVWIFPKGDDIANVGIGVLKNKTNKTAYEHLME
FIKTCPETKDAQPVEINVGGDPVGGIIKDRIGDNILVVGDAAGFVNSLTGGGINSALESG
VYAGIVAAQAIKDGDYSKNNLKEYVSLTDEHIGKHYKKYNKAKEYLLSLEDEELDEIAEE
FAKADFEEVNPRTLIKMLIKVSPKALVKLGKLF
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaactgatattttagtagttggagcaggaccttcaggatcactagcagcaaaa
gaagcagcattacatggtgctgatgttatattaatagatagaaaatctgaaataggatca
ccaaaacgttgtgctgaaggagtttccaaggatggattagcacaattaggtattaaacct
gatcctagatggattgcacgggatttatatggggtaagattagtatcaccaaataataca
agtgtatggatggataataatactattaaaatacctgaagcaggatatatacttgaaaga
aaagtatttgataaacatatggcaatggatgctgcacgtgctggtgctaaaataatgata
aaaacaaatgctacttccctaaaaagagtagatgatggaattattgttagtacaaaccat
atgggtaaagacatagatatacatgctaaaattgtaattgccgctgatggacctgaatct
cgtataggtagatgggctggacttgaatgtaacacagaatttaaatatatggaatcctgt
atacaatttgaaatggctggagttaatatggaaaacaatagggatattgcattgttcttt
ggaagtgttgctccaggaggatatgtatggatattccctaaaggtgatgacatagcaaat
gttggtattggagttcttaaaaataaaaccaataaaacagcatatgaacatttaatggaa
tttataaaaacttgtcctgaaactaaagatgctcaacctgttgaaataaatgttggtgga
gatcctgttggtggaattattaaagatagaattggagataacattcttgttgttggagat
gctgcaggttttgtaaattctttaactggtggtggaattaattctgcacttgaatctggt
gtatatgctggaattgttgcagctcaagctattaaagatggagattatagtaaaaacaat
cttaaagaatatgtttcattaactgatgaacatattggtaaacattataagaaatataat
aaagctaaagaatatcttttatcattagaagatgaagaacttgatgaaattgctgaagaa
tttgcaaaagctgactttgaagaagtaaatccaagaacattaattaaaatgttaattaag
gtttcacctaaagctttagttaaattaggtaaattattctaa

DBGET integrated database retrieval system