KEGG   Methanosphaera stadtmanae: Msp_1382Help
Entry
Msp_1382          CDS       T00313                                 

Gene name
tpiA
Definition
(GenBank) TpiA
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mst  Methanosphaera stadtmanae
Pathway
mst00010  Glycolysis / Gluconeogenesis
mst00051  Fructose and mannose metabolism
mst00562  Inositol phosphate metabolism
mst01100  Metabolic pathways
mst01110  Biosynthesis of secondary metabolites
mst01120  Microbial metabolism in diverse environments
mst01130  Biosynthesis of antibiotics
mst01200  Carbon metabolism
mst01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mst00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msp_1382 (tpiA)
   00051 Fructose and mannose metabolism
    Msp_1382 (tpiA)
   00562 Inositol phosphate metabolism
    Msp_1382 (tpiA)
Enzymes [BR:mst01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Msp_1382 (tpiA)
Exosome [BR:mst04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Msp_1382 (tpiA)
  Exosomal proteins of bladder cancer cells
   Msp_1382 (tpiA)
  Exosomal proteins of melanoma cells
   Msp_1382 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM NMO ThiG His_biosynth FMN_dh Glu_synthase IGPS B12-binding Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: ABC57754
UniProt: Q2NEJ9
Position
complement(1552205..1552882)
Genome map
AA seq 225 aa AA seqDB search
MSKNKTPIIILNYKTYTESTGKNAVKLSQYVQEASDETGINMAIAPQAVDLYPIIESVDI
PVYAQHMDAITPGGHTGSALPEALYETGIEGSLINHSEKRLTLADIDVVVEKTRQLDLTS
VLCTNNVKTSAACASFNPDFIAIEPPELIGTGIPVSQASPEVVENTVEEIHKINKNISVL
CGAGISTGEDMKAALDLGAQGVLLASGIIKAENQKEALIDLVSLI
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagaataagacaccaataataatacttaattataaaacatatacagaatcaaca
ggtaaaaatgcagtaaaattatcacagtatgttcaagaagcaagtgatgaaacaggtata
aatatggcaattgctccacaagcagttgatttatatccaattattgaatctgtggatatt
cctgtttatgctcaacacatggatgctataactcctggaggacatacaggttcagcttta
cctgaagctttatatgaaactggtatagagggtagtttaattaatcattcagagaaaaga
ttaactttggctgatattgatgttgttgttgaaaaaacaagacaactagatttaactagt
gtattatgtactaataatgttaaaacaagtgctgcctgtgcatcatttaatccagatttc
attgcaattgaaccacctgaattaattggtactggtattcctgtctctcaagctagtcct
gaagtagttgaaaatacagttgaagaaattcataaaattaacaagaatatatcagtatta
tgtggtgctggaatatctacgggagaagatatgaaagcagcattagatcttggtgctcaa
ggagttctactagcttctggtattattaaagcagaaaatcaaaaagaagctctaattgat
ttagttagtttaatttaa

DBGET integrated database retrieval system