KEGG   Mannheimia succiniciproducens: MS0401
Entry
MS0401            CDS       T00201                                 

Symbol
pflD
Name
(GenBank) PflD protein
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
msu  Mannheimia succiniciproducens
Pathway
msu00620  Pyruvate metabolism
msu00640  Propanoate metabolism
msu00650  Butanoate metabolism
msu01100  Metabolic pathways
msu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:msu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MS0401 (pflD)
   00640 Propanoate metabolism
    MS0401 (pflD)
   00650 Butanoate metabolism
    MS0401 (pflD)
Enzymes [BR:msu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     MS0401 (pflD)
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: AAU37008
UniProt: Q65VK2
Position
369464..371776
AA seq 770 aa
MAELTEAQKKAWEGFVPGEWQNGVNLRDFIQKNYTPYEGDESFLADATPATSELWNSVME
GIKIENKTHAPLDFDEHTPSTITSHKPGYINKDLEKIVGLQTDAPLKRAIMPYGGIKMIK
GSCEVYGRKLDPQVEFIFTEYRKTHNQGVFDVYTPDILRCRKSGVLTGLPDAYGRGRIIG
DYRRLAVYGIDYLMKDKKAQFDSLQPRLEAGEDIQATIQLREEIAEQHRALGKIKEMAAS
YGYDISGPATNAQEAIQWTYFAYLAAVKSQNGAAMSFGRTSTFLDIYIERDLKRGLITEQ
QAQELMDHLVMKLRMVRFLRTPEYDQLFSGDPMWATETIAGMGLDGRPLVTKNSFRVLHT
LYTMGTSPEPNLTILWSEQLPEAFKRFCAKVSIDTSSVQYENDDLMRPDFNNDDYAIACC
VSPMVVGKQMQFFGARANLAKTMLYAINGGIDEKNGMQVGPKTAPITDEVLNFDTVIERM
DSFMDWLATQYVTALNIIHFMHDKYAYEAALMAFHDRDVFRTMACGIAGLSVAADSLSAI
KYAKVKPIRGDIKDKDGNVVASNVAIDFEIEGEYPQFGNNDPRVDDLAVDLVERFMKKVQ
KHKTYRNATPTQSILTITSNVVYGKKTGNTPDGRRAGAPFGPGANPMHGRDQKGAVASLT
SVAKLPFAYAKDGISYTFSIVPNALGKDDEAQKRNLAGLMDGYFHHEATVEGGQHLNVNV
LNREMLLDAMENPEKYPQLTIRVSGYAVRFNSLTKEQQQDVITRTFTQSM
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggctgaattaactgaagctcaaaaaaaagcatgggaaggattcgttcccggtgaatgg
caaaacggcgtaaatttacgtgactttatccaaaaaaactatactccgtatgaaggtgac
gaatcattcttagctgatgcgactcctgcaaccagcgagttgtggaacagcgtgatggaa
ggcatcaaaatcgaaaacaaaactcacgcacctttagatttcgacgaacatactccgtca
actatcacttctcacaaaccaggttatatcaataaagatttagaaaaaatcgttggtctt
caaacagatgctccgttaaaacgtgcaattatgccgtacggcggtatcaaaatgatcaaa
ggttcttgcgaagtttacggtcgtaaattagatccgcaagtagaatttattttcaccgaa
tatcgtaaaacccataaccaaggcgtattcgacgtttatacgccggatattttacgctgc
cgtaaatcaggcgtgttaaccggtttaccggatgcttacggtcgtggtcgtattatcggt
gactaccgtcgtttagcggtatacggtatcgattacctgatgaaagataaaaaagcccaa
ttcgattcattacaaccgcgtttggaagcgggcgaagacattcaggcaactatccaatta
cgtgaagaaattgccgaacaacaccgcgctttaggcaaaatcaaagaaatggcggcatct
tacggttacgacatttccggccctgcgacaaacgcacaggaagcaatccaatggacatat
tttgcttatctggctgcggttaaatcacaaaacggtgcggcaatgtcattcggtcgtacg
tctacattcttagatatctatatcgaacgtgacttaaaacgcggtttaatcactgaacaa
caggcgcaggaattaatggaccacttagtaatgaaattacgtatggttcgtttcttacgt
acgccggaatacgatcaattattctcaggcgacccgatgtgggcaactgaaactatcgcc
ggtatgggcttagacggtcgtccgttggtaactaaaaacagcttccgcgtattacatact
ttatacactatgggtacttctccggaaccaaacttaactattctttggtccgaacaatta
cctgaagcgttcaaacgtttctgtgcgaaagtatctattgatacttcctccgtacaatac
gaaaacgatgacttaatgcgtcctgacttcaacaacgatgactacgcaatcgcatgttgc
gtatcaccgatggtcgtaggtaaacaaatgcaattcttcggtgcgcgcgcaaacttagct
aaaactatgttatacgcaattaacggcggtatcgatgagaaaaacggtatgcaagtcggt
cctaaaactgcgccgattacagacgaagtattgaatttcgataccgtaatcgaacgtatg
gacagtttcatggactggttggcgactcaatatgtaaccgcattgaacatcatccacttc
atgcacgataaatatgcatatgaagcggcattgatggcgttccacgatcgcgacgtattc
cgtacaatggcttgcggtatcgcgggtctttccgtggctgcggactcattatcagcaatc
aaatatgcgaaagttaaaccgattcgcggcgacatcaaagataaagacggtaatgtcgtg
gcctcgaatgttgctatcgacttcgaaattgaaggcgaatatccgcaattcggtaacaat
gatccgcgtgttgatgatttagcggtagacttagttgaacgtttcatgaaaaaagttcaa
aaacacaaaacttaccgcaacgcaactccgacacaatctatcctgactatcacttctaac
gtggtatacggtaagaaaaccggtaatactccggacggtcgtcgagcaggcgcgccattc
ggaccgggtgcaaacccaatgcacggtcgtgaccaaaaaggtgcggttgcttcacttact
tctgtggctaaacttccgttcgcttacgcgaaagacggtatttcatataccttctctatc
gtaccgaacgcattaggtaaagatgacgaagcgcaaaaacgcaaccttgccggtttaatg
gacggttatttccatcatgaagcgacagtggaaggcggtcaacacttgaacgttaacgtt
cttaaccgtgaaatgttgttagatgcgatggaaaatccggaaaaatacccgcaattaacc
attcgtgtttcaggttatgcggttcgtttcaactcattgactaaagaacaacaacaagac
gttatcactcgtacgtttacacaatcaatgtaa

DBGET integrated database retrieval system