KEGG   Mannheimia succiniciproducens: MS0017Help
Entry
MS0017            CDS       T00201                                 

Gene name
cysQ
Definition
(GenBank) CysQ protein
  KO
K01082  3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
msu  Mannheimia succiniciproducens
Pathway
msu00920  Sulfur metabolism
msu01100  Metabolic pathways
msu01120  Microbial metabolism in diverse environments
msu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:msu00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    MS0017 (cysQ)
Enzymes [BR:msu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     MS0017 (cysQ)
Transfer RNA biogenesis [BR:msu03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    MS0017 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-ProteinID: AAU36624
UniProt: Q65WN6
Position
complement(15761..16564)
Genome map
AA seq 267 aa AA seqDB search
MQITQQLLDDVLKIASLAGEHLKTFYAKSVNVEIKTDNTPVTEADLFLSQFLIEKLTVLT
PDIPVLSEENCNIPLAERQKWQSYWLIDPVDGTQQFINHTGQFSIMICLVQDNQPQLGII
HAPIIGKTYYARRGLGAFLIENGCCRKLPPLQPHNHQHIKITIGSSNPEKIRQSVQPPYK
ADLLLYGSSSLKSGLVAEGVADCYVRLGNTGEWDTAAAEVLLNEVGGKIFNLQYRPLTYN
QRETLVNPHFVMANAQLDWKKIFRFDL
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcaaataactcaacaacttctcgatgacgtattgaaaatcgcctcattagcgggcgaa
catctaaaaacattctatgcaaaatccgtgaacgtagaaataaagacggacaatacaccc
gttacggaagccgatttatttttgagccaatttctaatcgaaaaattaaccgtactaacg
ccggatattcccgtgctctcggaggaaaactgcaacattccgctggccgaacgtcaaaaa
tggcagtcttactggttaattgatccggtggacggtacacaacaatttatcaatcatacc
gggcaattttccattatgatttgcctggttcaggataatcaaccgcaactcggcattatc
catgccccaatcataggaaaaacctattatgcccgtcggggactaggcgcttttctgatt
gaaaacggctgttgccgaaaacttccgccgcttcaaccacacaatcatcagcacatcaaa
attaccatcggttcgtctaatccggaaaaaatccgccaatccgtacaaccgccttataag
gcggatctgttattgtacggatccagcagtttgaaatccggccttgttgccgaaggcgtg
gcggactgttacgttcgtttgggcaatacgggtgaatgggataccgcagcggcagaagta
ttgctgaatgaagtgggcggcaaaatttttaatttacaataccggcctctcacttataat
cagcgagaaacattagtgaatccccattttgtcatggctaatgcacaattggattggaaa
aaaatctttcgatttgatttgtaa

DBGET integrated database retrieval system