KEGG   Mannheimia succiniciproducens: MS0039Help
Entry
MS0039            CDS       T00201                                 

Gene name
oadA
Definition
(GenBank) OadA protein
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
msu  Mannheimia succiniciproducens
Pathway
msu00620  Pyruvate metabolism
msu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MS0039 (oadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:msu02000]
    MS0039 (oadA)
Enzymes [BR:msu01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     MS0039 (oadA)
Transporters [BR:msu02000]
 Other transporters
  Primary active transporters [TC:3]
   MS0039 (oadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_D23 Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: AAU36646
UniProt: Q65WL4
Position
complement(36561..38369)
Genome map
AA seq 602 aa AA seqDB search
MTKKIKFTDVVLRDAHQSLFATRLRLDDMLPIAAELDKIGYWSLEAWGGATFDSCIRFLG
EDPWVRLRELKKAMPKTPLQMLLRGQNLLGYRHYADDVVDKFVERCVANGMSVFRVFDAL
NDPRNMQQALTAVKKQGGHAQGTLSYTTSPVHTLDTWLNVTEQLLEIGIDSLVIKDMSGI
LNPMAAGELVGAIKGKFGDDVELHLHCHSTTGMAEMALLKAIEAGADGIDTSISSMSGTY
GHPATESLVATLQGTEYDSGLDIPSLEKIAAYFRDVRKKYAKFEGQLRGIDSRILVAQVP
GGMLTNLESQLKQQNAADKLDAVLQEIPRVREDLGYIPLVTPTSQIVGTQSVINVLMGER
YKTIAKETAGILKGEYGRTPAPVNAELQARVLEGNQPITDRPANHIAPEMDKLAAEVKQQ
AAEKGIKLAENEIDDVLIVALFPQIGLKFLENRGNPAAFEPVPTAEQAPAKAAAPVAPKA
QSGAAVYTVELEGKAFVVKVSEGGDITNIAPTQTSNAVPAPQAAPVAAPASGGTPVTAPM
AGNIWKVVATEGQKVAEGDVLLILEAMKMETEIKAAQAGTVQGIAVKAGDAVAVGDTLMT
LA
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaaattaaatttacagatgttgttcttcgtgatgcacaccaatctcttttt
gcaacacgcttacgtcttgatgatatgctcccgattgccgccgagcttgataaaatcggt
tattggtctttagaagcctggggaggcgcaacttttgactcctgtatccgtttcttaggt
gaagatccttgggtacgtttgcgtgagttgaaaaaagcaatgccgaaaactccgctgcaa
atgttattacgcggtcaaaacttactaggttatcgtcattatgccgatgacgtagtggat
aaattcgtagaacgttgcgttgcaaacggtatgagcgtattccgcgtattcgacgcctta
aatgacccccgcaatatgcaacaagccttaaccgcagtgaaaaaacaaggtggtcacgca
caaggtaccttaagttatacaacaagccccgttcatactttagatacgtggttaaacgtc
accgagcaattgcttgagataggtattgacagcttagtcattaaagacatgtccggtatt
ttaaatccaatggcggccggcgaattggtcggtgcgattaaaggcaaattcggcgatgat
gttgaactccacttacattgccactctacgacaggtatggcggaaatggcattattaaaa
gccattgaagcgggtgccgacggtattgatacttctatttcttctatgtccggcacttac
ggtcatccggcaaccgaatctttagtagcgacattgcaaggtaccgaatacgattcaggt
ttggatattcctagccttgagaaaattgccgcatatttccgcgacgtgcgtaaaaaatat
gccaaattcgaaggtcaattacgcggtatcgacagccgtattctggtcgctcaagtaccg
ggcggtatgctgactaatcttgaaagccaattaaaacaacaaaatgcggcggacaagtta
gatgcggtattacaagaaattccacgtgttcgtgaagatctcggttatattccgttggtt
acgccaacctctcaaatcgtgggtactcaatccgttatcaacgtgttaatgggcgaacgt
tacaaaactatcgcaaaagaaaccgcaggtattctcaaaggcgaatacggtcgcacgccg
gctccggttaatgccgaattacaggcccgcgtattggaaggtaatcaaccgattaccgac
cgcccggctaatcatattgcaccggaaatggataaattagcggcggaagtaaaacaacaa
gcggcggaaaaaggcattaaattggctgaaaatgaaattgacgatgtattaatcgttgct
ctgttcccgcaaatcggccttaaattcttagaaaatcgcggcaacccggctgcattcgaa
ccggttccgaccgctgaacaggctccggctaaagctgccgctccggtcgcgccaaaagca
caatccggagcggcggtttataccgtcgaacttgaaggtaaagcctttgtggtgaaagta
agcgaaggcggcgatatcactaatattgcgccgacccaaacatctaacgctgttcctgca
ccgcaagcggctccggttgcggcacctgcatcaggcggcacaccggtcaccgcgcctatg
gcgggtaacatctggaaagtggttgctaccgaaggtcaaaaagtggcggaaggcgatgta
ttgttaattcttgaagcaatgaaaatggaaactgaaattaaagcggctcaagcaggtacg
gtacaaggtatcgcagtcaaagcaggtgatgctgttgcagtaggcgatacattaatgact
ttagcttaa

DBGET integrated database retrieval system