KEGG   Mannheimia succiniciproducens: MS0066Help
Entry
MS0066            CDS       T00201                                 

Gene name
pdxA
Definition
(GenBank) PdxA protein
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
msu  Mannheimia succiniciproducens
Brite
KEGG Orthology (KO) [BR:msu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MS0066 (pdxA)
Enzymes [BR:msu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     MS0066 (pdxA)
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     MS0066 (pdxA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA
Motif
Other DBs
NCBI-ProteinID: AAU36673
UniProt: Q65WI7
Position
66788..67789
Genome map
AA seq 333 aa AA seqDB search
MKPILGITMGDAAGIGPEVIIKALEDKRIYDLAHPVVVGDFKIMQRALPIVKSNLKLRKV
DDVDHYQSEFGYIDVIDLDNLPADLPFAKVDARAGKAAYEFIERAVDLTLKGKIHAIVTA
PLNKEALHAGGKMFPGHTEILAKLSNTEDFSMMLTSEKLNVIHVTTHVSMRQACDLIKKE
RVLTVIELAQEYTKMLGFKEPRIAVAGFNAHAGEHGLFGTEDEEEILPAVKEAQAKGINV
IGPIPPDTVFHRAANLDEFDMVVVMYHDQGHIPLKLIGFDSGVNVTTGLPFIRTSVDHGT
AFQIAGQGIADSRSMTEALYLGAKMANIKYSNQ
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctattttaggtattacgatgggcgatgcggctggtattggccctgaggtgatt
attaaagcattagaagacaaacggatttatgacttggctcatcctgttgttgtgggtgat
tttaaaattatgcaacgggcgttgcctattgttaaatccaatctcaaactgcgtaaagta
gatgatgtcgatcattaccaaagcgagtttggctatattgatgtaatcgacttagataat
ttacctgctgatcttccctttgcaaaagtagatgctcgtgcggggaaagcggcttatgaa
tttattgagcgggcagtagatctcacattaaaaggaaaaattcacgcaattgtgaccgca
cctttaaacaaagaagcgcttcatgcaggcggtaaaatgtttccgggacatactgaaatt
ttggcgaaactgagtaatacggaagatttttcgatgatgctaacaagtgaaaaattgaat
gttattcatgtcactacacatgtttcaatgcgccaagcctgcgatttaattaaaaaagaa
cgcgtattaactgtgattgaactcgctcaagaatataccaaaatgcttggttttaaagag
cctcgtattgcggtggcggggtttaatgcgcatgcgggagaacatggtttattcggtacg
gaagacgaagaagaaattctacctgccgtaaaagaagcgcaagccaaaggtattaatgtt
atcggtccaattcctccggatacggtattccatcgcgcagcaaatttagatgagtttgat
atggtggttgtgatgtatcacgatcaaggtcatatcccattaaaactcatcggttttgat
agcggtgtaaatgtcactacaggtttgccttttatccgaacttcggttgaccacggtacc
gcattccagattgcaggtcaaggtattgccgatagtcgtagtatgactgaagctttatac
cttggtgccaaaatggcaaatattaaatattcaaatcaataa

DBGET integrated database retrieval system