KEGG   Mannheimia succiniciproducens: MS0377Help
Entry
MS0377            CDS       T00201                                 

Gene name
pfkA
Definition
(GenBank) PfkA protein
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
msu  Mannheimia succiniciproducens
Pathway
msu00010  Glycolysis / Gluconeogenesis
msu00030  Pentose phosphate pathway
msu00051  Fructose and mannose metabolism
msu00052  Galactose metabolism
msu00680  Methane metabolism
msu01100  Metabolic pathways
msu01110  Biosynthesis of secondary metabolites
msu01120  Microbial metabolism in diverse environments
msu01130  Biosynthesis of antibiotics
msu01200  Carbon metabolism
msu01230  Biosynthesis of amino acids
msu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:msu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MS0377 (pfkA)
   00030 Pentose phosphate pathway
    MS0377 (pfkA)
   00051 Fructose and mannose metabolism
    MS0377 (pfkA)
   00052 Galactose metabolism
    MS0377 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    MS0377 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MS0377 (pfkA)
Enzymes [BR:msu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MS0377 (pfkA)
Protein phosphatases and associated proteins [BR:msu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MS0377 (pfkA)
Messenger RNA biogenesis [BR:msu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MS0377 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AAU36984
UniProt: Q65VM6
Position
347749..348714
Genome map
AA seq 321 aa AA seqDB search
MIKKIAVLTSGGDAPGMNAAIRGVVRSALFEGLEVFGVYDGYYGLYHNKIKQLNRYSVSD
VITRGGTFLGSARFPEFKNPEVRAKCAEILRSHGIDALVVIGGDGSYTGAKLLTEEHGIQ
CIGLPGTIDNDAPGTDYTIGYQTALETAVDAIDRLRDTSSSHQRISIVEIMGRHCSDLTI
NAALAGGCEYIVASEVEFDQEELIQQIERSIANGKRHAIIAITELITDVHELAKRIEERV
HHETRATVLGHVQRGGSPCAFDRILASRMGVYAVDLLLQGKGGYCVGIQNEQLVHHDIID
AINNMRRSFKAELLDMNERLF
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaattgctgtattgacaagtggtggcgatgcacccggcatgaatgccgcg
attcgcggcgttgtgcgttctgcattgtttgaaggattggaagtatttggcgtctatgac
ggttattatgggctataccataataaaatcaaacaattgaaccgttatagcgtatccgat
gttattaccagagggggcactttcttgggttctgcacgtttcccggaatttaaaaatcct
gaagtgcgggcaaaatgtgcagaaattttacgttctcatggtattgatgcattagtcgta
atcggcggtgacggttcatataccggggctaaattattaaccgaagaacatggcatccaa
tgtataggtttgccgggtactattgataatgacgcaccgggtacggactatacgattggt
tatcaaaccgcattagaaacggcggttgatgcgattgaccgtttacgtgatacctcaagt
tcgcaccaacgtatttctattgtggagattatggggcgccattgcagcgatttgacgatt
aatgctgcgcttgccggtggatgtgaatatattgtggcttcggaagtcgaatttgatcaa
gaggaattaattcaacaaattgagcgcagcattgctaatggtaaacgccacgcaattatt
gcaataacggaattaattactgatgttcatgagttagctaaaagaattgaagaacgcgtt
caccatgaaacccgtgccacagtattaggtcatgttcaacgcggcggttctccttgtgct
tttgaccgtattcttgcatcccgtatgggggtttatgcggttgatttgttattacaaggt
aaaggcggatattgtgtcggtattcaaaacgagcaattagtccatcatgatatcattgac
gcaatcaataacatgagacgttcatttaaggctgaattgttagacatgaacgagagatta
ttctaa

DBGET integrated database retrieval system