KEGG   Mannheimia succiniciproducens: MS0601
Entry
MS0601            CDS       T00201                                 

Gene name
ccmA
Definition
(GenBank) CcmA protein
  KO
K02193  heme exporter protein A [EC:7.6.2.5]
Organism
msu  Mannheimia succiniciproducens
Pathway
msu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:msu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    MS0601 (ccmA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:msu02000]
    MS0601 (ccmA)
Enzymes [BR:msu01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.5  ABC-type heme transporter
     MS0601 (ccmA)
Transporters [BR:msu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Heme transporter
    MS0601 (ccmA)
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N RsgA_GTPase DUF3584 NACHT AAA_23 AAA_16 zf_CCCH_4
Other DBs
NCBI-ProteinID: AAU37208
UniProt: Q65V02
Position
563326..563973
AA seq 215 aa
MQSVNQLKIDRLACQRGDKILFTDLSFNLQSGDFVQIEGHNGIGKTSLLRILAGLAQPLS
GKVRWNSEEISKCREEYYYDLLYLGHHAGIKPELTAWENLKFYQQAGHCRQGDEILWNVL
EKVGLLGREDIVASQLSAGQQKRIALARLWISQAPLWILDEPFNAIDKNGVKVLTGLFEQ
QAEKGGIVILTSHQEVPSSALTVLNLAQYKFTDNE
NT seq 648 nt   +upstreamnt  +downstreamnt
atgcaatcagtaaatcaattaaaaattgaccgtcttgcttgtcagcgaggcgataaaatt
ctgtttacggatctgtcgtttaatttgcagtccggcgactttgttcagattgaagggcat
aacggtatcggcaaaaccagtttattgcggattttagcggggcttgctcagccgttgtcc
ggaaaagtgcggtggaattctgaagagatttctaaatgccgcgaagaatattattatgat
ttgctttatttaggacatcatgcggggattaaaccggaattaactgcatgggaaaatctg
aaattttatcagcaggcgggtcattgccgacaaggtgatgaaattttgtggaatgtactt
gaaaaggtggggttgttaggcagagaagatattgtcgcaagccagctttcggcggggcaa
caaaagcgtattgcactggcgagattgtggatttcgcaagcgcctttatggattttagac
gagccttttaatgctattgataaaaatggcgtaaaggtgttgaccgggctttttgaacaa
caggcggaaaagggcggtatcgttattttaaccagccatcaggaagtaccgagttcagcg
ttaaccgtacttaatttagcgcaatataaatttacggataatgaataa

DBGET integrated database retrieval system