KEGG   Mannheimia succiniciproducens: MS0941Help
Entry
MS0941            CDS       T00201                                 

Gene name
metE
Definition
(GenBank) MetE protein
  KO
K00549  5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase [EC:2.1.1.14]
Organism
msu  Mannheimia succiniciproducens
Pathway
msu00270  Cysteine and methionine metabolism
msu00450  Selenocompound metabolism
msu01100  Metabolic pathways
msu01110  Biosynthesis of secondary metabolites
msu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:msu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    MS0941 (metE)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    MS0941 (metE)
Enzymes [BR:msu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.14  5-methyltetrahydropteroyltriglutamate---homocysteine S-methyltransferase
     MS0941 (metE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Meth_synt_2 URO-D
Motif
Other DBs
NCBI-ProteinID: AAU37548
UniProt: Q65U12
Position
917370..918518
Genome map
AA seq 382 aa AA seqDB search
MTKLFPNATVRTSAPYRFDIVGSFLRSDAIKSARAACACGDISCADLTRAEDAEIAKLVE
RQKSVGLHAVTDGEFRRTFWHLDFLAGLDGVEEVDAEKFSVQFKHHNVRPKTLKIVAKVD
FSENHPFVEHFRSVNELAKGTEVKFTIPSPSMLHLITNVRATNYQPIPRYENNNQQLLDD
IADAYIKAMNIFYKLGCRNLQLDDTSWGEFCAEDKRAAYQERGFDLDQIAKDYVYMLNKI
VDAKPAQDIAITMHICRGNFRSTWFSAGGYEPVAEILFGSCRVDGFFLEYDSDRAGDFKP
LRFIKNQQVVLGLVTSKDGTLENREDIINRIKEAAQYVDINQLCLSPQCGFASTEEGNIL
TEEQQWAKLNFIREIAEEVWGK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagttattcccaaacgcaacagtacgtacttcggcaccttaccgttttgatatt
gtcggtagttttttgcgctccgacgccataaaatccgcaagagcggcttgcgcctgcggt
gatatttcatgcgccgatttaactcgggcggaggatgcggaaatcgcaaaattagtagaa
cggcaaaaatccgtcggtctgcatgcggtaacagacggcgaattccgtcgtacattctgg
catttggactttttagccggtttagacggtgtggaagaagtggatgccgaaaagttttcc
gtacagttcaaacatcataatgtgcgcccgaaaaccttgaaaattgtcgctaaagtggat
ttttcggaaaatcatcctttcgttgaacatttccgttccgtaaatgaattggcaaaaggc
accgaagtgaaatttactattccttcgccttctatgctgcatttaatcaccaatgtgcga
gcgacaaattatcaaccgattccccgttatgaaaataacaaccagcaattattggatgac
atcgccgacgcttacattaaagcaatgaatattttctataaactgggttgtcgtaatctg
caattagacgacaccagttggggtgagttttgtgcggaagataaacgcgccgcttatcag
gaacggggctttgatttagaccaaatcgctaaggactacgtgtatatgctcaataaaatc
gtggacgccaaaccagcgcaggatattgcgatcaccatgcacatctgccgcggtaatttc
cgttcaacctggttttcggcgggcggttatgaacccgtggcggaaattttattcggcagc
tgccgggtggacggttttttcttagaatacgattctgatcgcgccggcgattttaaacct
ttacgtttcatcaagaatcagcaagtggtactgggcttggttacgtcgaaagacggcaca
ttggaaaaccgtgaggacatcattaaccgcattaaagaagcggcgcaatatgtggatatt
aaccagctctgtttaagcccgcaatgcggttttgcttcgacggaagaaggcaatatccta
acggaagaacagcaatgggcaaaactcaactttattcgtgaaattgcggaagaagtctgg
ggtaaatag

DBGET integrated database retrieval system