KEGG   Mannheimia succiniciproducens: MS1354Help
Entry
MS1354            CDS       T00201                                 

Gene name
aceF
Definition
(GenBank) AceF protein
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
msu  Mannheimia succiniciproducens
Pathway
msu00020  Citrate cycle (TCA cycle)
msu00310  Lysine degradation
msu01100  Metabolic pathways
msu01110  Biosynthesis of secondary metabolites
msu01120  Microbial metabolism in diverse environments
msu01130  Biosynthesis of antibiotics
msu01200  Carbon metabolism
Module
msu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
msu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:msu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MS1354 (aceF)
  Amino acid metabolism
   00310 Lysine degradation
    MS1354 (aceF)
Enzymes [BR:msu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MS1354 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: AAU37961
UniProt: Q65SU9
Position
complement(1356858..1358066)
Genome map
AA seq 402 aa AA seqDB search
MSNFDIITPDLPESVADATVVKWHKAVGDKVRRDEVLVEIETDKVVLEVPALNDGIIESI
IEPEGATVVSKQLLGKAALLPVGEVTVRAETPTVAPQIEDSAVASSADTLGPAARRLIAE
HDLNVNEIKGSGVSGRITREDVEAVIAQKAASVAAKSAVENTVISSPAAVRTEKRVPMTR
LRKRVAERLLEVKNSTAMLTTFNEVDMQPIMQLRKKYAEKFEKQHDTRLGFMSFYVKAVV
EALKRYPVINASIDGDDIVYHNYFDISIAVSTPRGLVTPVIRNCDKLSMAEIERQIKALA
EKGRDGKLTVDDLTGGNFTITNGGVFGSLMSTPIINPPQAAILGMHAIKDRPVAIDGQVA
IRPMMYLALSYDHRLIDGKDSVGFLVTVKELLEDPTRLLLEI
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagtaactttgatattatcacccctgatttaccggaatccgtggcggatgcaaccgtt
gtaaaatggcataaagcggttggcgataaagtacggcgcgacgaagtattggttgaaatt
gaaacggataaagttgtactggaagtaccggcgctaaatgacggtattatcgaatctatc
atagagcccgaaggggcaacggttgtaagcaaacaattattaggcaaggcggcattgctt
ccggtaggcgaagtaaccgtacgggcggaaacaccgacggtggcgccgcaaattgaggat
tcagccgttgcgtcctctgccgataccctagggcctgccgctcgccgcttaattgccgag
catgatttaaatgttaatgaaattaaaggcagtggggtgagcggtcgcattacccgtgaa
gatgtggaagcggtgatcgcacaaaaagccgcatcggttgccgcgaaaagtgcggtggaa
aataccgtaatttcgtcgccggcagccgttcgcacggaaaaacgcgtgccgatgacccgt
ttgcgtaaacgggtggcggagcgtttgctggaagtgaaaaacagtaccgcaatgttaacc
actttcaacgaagtggatatgcaacctattatgcagttacgcaaaaaatatgctgaaaaa
tttgaaaagcagcatgacacccgattaggttttatgtccttttatgtgaaagcggttgtg
gaagcattgaagcgttatccggtaatcaatgcatctattgatggtgacgacattgtttat
cacaattattttgatatcagcatcgccgtttccaccccgcgcggtttggttacgccggtt
atccgtaattgcgataaattgagcatggctgaaatcgaacgccaaattaaagcgctggcg
gaaaaaggccgtgacggtaaattaacggtggatgatttaaccggcggtaactttaccatt
acaaacggcggcgtattcggttcattaatgtctacgccgatcattaacccgccgcaagcg
gctattttaggtatgcacgccattaaagaccgcccggtggctattgacggacaggtagcg
attcgcccgatgatgtatttagcattgtcttacgaccaccgtcttattgacggcaaagat
tccgtcggttttttagttacggtcaaagagcttttagaggatccgaccagattattgtta
gaaatttag

DBGET integrated database retrieval system