KEGG   Methanobacterium subterraneum: BK009_04030Help
Entry
BK009_04030       CDS       T05275                                 

Definition
(GenBank) aromatic acid decarboxylase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
msub  Methanobacterium subterraneum
Pathway
msub00130  Ubiquinone and other terpenoid-quinone biosynthesis
msub00627  Aminobenzoate degradation
msub01100  Metabolic pathways
msub01110  Biosynthesis of secondary metabolites
msub01120  Microbial metabolism in diverse environments
msub01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:msub00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    BK009_04030
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BK009_04030
Enzymes [BR:msub01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     BK009_04030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AUB59917
UniProt: A0A2H4VDP4
Position
complement(860841..861401)
Genome map
AA seq 186 aa AA seqDB search
MIVVAITGASGVIYGVRLLEVLKEMGRKTALVVTDPARIILKYEMGMDEDELKGLCHKFY
DPGDLTSAINSGSCRFESMVIVPCTMKTISAISTGFASNAVTRAADVVLKERRTLLLVPR
ETPLRSVHLENMLSISREGAIILPAMPAFYHQPQNMDDLVDFLVGKILDVLHIDHNLYQR
WQGEVP
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgatagtggtagccataactggagctagcggcgttatttacggtgtcagactcctggaa
gtattgaaagaaatgggaaggaaaactgccctggtggtaactgacccggcacgtatcatc
ctgaaatacgaaatggggatggatgaagatgaactaaagggactttgtcacaagttttat
gatccaggagaccttaccagtgccattaacagtggttcctgccgttttgaatccatggtc
attgtcccctgtaccatgaagaccatttctgcaatatccactggttttgccagcaatgcg
gttacccgggctgcagatgtagttttgaaggagagaagaacgttactcctggtgccccgc
gaaacgcctttacgttcagttcatttagagaatatgctaagtatcagccgtgaaggtgca
ataatcctcccagcaatgcctgctttttaccaccaaccccagaacatggatgatctggtt
gatttcctagtgggtaaaatactggatgttctccatattgaccataacctctaccagaga
tggcagggagaggtcccatga

DBGET integrated database retrieval system