KEGG   Methanobacterium subterraneum: BK009_04045Help
Entry
BK009_04045       CDS       T05275                                 

Definition
(GenBank) nicotinamide-nucleotide adenylyltransferase
  KO
K00952  nicotinamide-nucleotide adenylyltransferase [EC:2.7.7.1]
Organism
msub  Methanobacterium subterraneum
Pathway
msub00760  Nicotinate and nicotinamide metabolism
msub01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msub00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BK009_04045
Enzymes [BR:msub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     BK009_04045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: AUB59920
UniProt: A0A2H4VPD0
Position
complement(863322..863846)
Genome map
AA seq 174 aa AA seqDB search
MRGLLVGRMQPVHRGHIQVMERILNDVEEVIIGIGSAQVSHSLKDPFTAGERVMMITKAL
AENDIPASCYYIIPVQDIECNSLWVAHMEMLTPPFEHVYSGNPLVQRLFHEKGYQVTEPP
LFNRKSYSGTEVRRRMLAGDNWEKLVPESVVEVINEIDGIARIKQLARKEVSEV
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgagaggacttctggtggggagaatgcaaccggtgcaccggggacatattcaggtaatg
gaaaggatcctgaatgatgtggaagaagtgatcattggaattggtagtgcgcaggtcagt
cacagtcttaaagatccattcaccgccggagagagggtgatgatgatcactaaggccctg
gcagaaaatgacataccagcatcctgttactacatcataccagtgcaggatatagagtgt
aactccctctgggtggcccatatggaaatgttaaccccaccatttgaacatgtctactct
ggcaacccactggtccagagactttttcatgaaaagggttatcaggttaccgaaccccca
ttatttaacagaaaaagctattccgggacagaagttcggcgtagaatgctagctggtgat
aactgggaaaaattagtcccagaatcagtagtagaagttattaatgaaattgatggtatt
gctagaattaaacaactagccagaaaggaggtaagtgaagtatga

DBGET integrated database retrieval system