KEGG   Methanobacterium subterraneum: BK009_04905Help
Entry
BK009_04905       CDS       T05275                                 

Definition
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01959  pyruvate carboxylase subunit A [EC:6.4.1.1]
Organism
msub  Methanobacterium subterraneum
Pathway
msub00020  Citrate cycle (TCA cycle)
msub00620  Pyruvate metabolism
msub00720  Carbon fixation pathways in prokaryotes
msub01100  Metabolic pathways
msub01120  Microbial metabolism in diverse environments
msub01200  Carbon metabolism
msub01230  Biosynthesis of amino acids
Module
msub_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:msub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BK009_04905
   00620 Pyruvate metabolism
    BK009_04905
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    BK009_04905
Enzymes [BR:msub01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     BK009_04905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp_3 RimK ATP-grasp GARS_A ATP-grasp_5 S6PP ATP-grasp_4 ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: AUB60077
UniProt: A0A2H4VPR3
Position
1033940..1035427
Genome map
AA seq 495 aa AA seqDB search
MFDKVLVANRGEIAIRVMRACRELDVKSVAVYSDADKNSLFAKYADESYHIGGPSPGDSY
LNIPRILEVAEKSGADAVHPGYGFLAENPHLGDECSKQGMKLIGPSGSVIEAMGSKIESR
KLMEKAGVPVIPGNSKGVTDPDEALKIAEAIGYPVIVKASAGGGGIGMRTVYEEDELLRA
LESTQSVAESAFGDSTVFIEKYVEEPRHIEFQILADEHGNTIHVADRECSIQRRHQKLIE
EAPSPIMTDELRDQMGSTAVKAASAIDYTNAGTVEFLYSHGEFYFLEMNTRIQVEHPITE
VVTGVDLVKEQLKIASGRELCCSQEDIQVRGHAIECRINAEDPLADFAPNPGKITGYRSP
GGPGVRVDSGVYMNYTIPPYYDSMISKLIVWGSTRNEAITRMRRALSEYIILGVKTTIPF
HKSMMLSPNFWEAKLHTHFVDEYRKEIMDNMAKIIQKDKEMETRLKSTFLPSKRVAAISA
AVNSHLTSTMTNNKK
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtttgacaaggttctggttgctaaccgtggagaaatcgccatcagagtgatgcgcgcc
tgcagagagctggacgtgaagagtgtggcggtgtattcagacgcggataaaaattcactc
ttcgccaagtacgccgatgaatcctaccacataggaggaccatcacctggagatagctac
ctgaatataccccgaattctggaagttgccgaaaaatcaggggcagatgcagtgcaccct
ggatatggtttcctggctgaaaacccccaccttggagatgaatgttccaaacaggggatg
aaactaataggaccatcaggttcagttattgaagccatgggaagtaagattgaatcccgt
aaactcatggaaaaggcaggggtgccagtgataccaggtaacagtaagggagtcaccgac
ccggatgaagccctaaaaatagcggaggccattggttacccggtgatagtgaaggcatct
gcaggtggtggtggaataggcatgcgaacagtttacgaggaagatgaacttctacgcgcc
ctggaatccacccaatccgttgccgaatctgcattcggagattccactgttttcatagaa
aaatatgtggaggaaccccgccatattgaattccagatcctggcggatgaacacggtaac
accatccacgtggctgaccgtgagtgcagtatccagcgccgacaccaaaaactaattgaa
gaagcgccgtcccccatcatgactgatgaactccgggaccagatgggatcaacagctgtg
aaagctgcatcagcaattgactacaccaatgccgggactgtggaattcttatactcccat
ggagagttttatttcctggaaatgaacacccgtatccaggtggagcatcccataaccgaa
gtggttaccggggtggacctggttaaagaacaactgaaaatagcctccggtcgagaatta
tgctgctcccaggaggatatccaggtgaggggccatgccattgaatgccggatcaatgct
gaggatccactggcagatttcgcccccaatcccggtaagataacgggttatcgttccccg
ggaggtccgggagtgcgagtggacagtggggtttacatgaactacaccatacccccctac
tatgattccatgatctccaaactcattgtatggggaagtacccgtaacgaagccataaca
cggatgagacgggccctctcagaatacattatactgggagtgaaaaccaccatccccttc
cataagtccatgatgttaagtcccaatttctgggaagcaaaactacacacccactttgtt
gatgaataccggaaggaaataatggataacatggcaaagatcatccagaaagataaggaa
atggaaacccggctaaaatcaaccttcctaccatctaaaagggtggctgcaatttcagca
gcagttaacagtcacctgaccagtaccatgaccaacaacaaaaaataa

DBGET integrated database retrieval system