KEGG   Methanobacterium subterraneum: BK009_07400Help
Entry
BK009_07400       CDS       T05275                                 

Definition
(GenBank) tetrahydromethanopterin S-methyltransferase subunit E
  KO
K00581  tetrahydromethanopterin S-methyltransferase subunit E [EC:2.1.1.86]
Organism
msub  Methanobacterium subterraneum
Pathway
msub00680  Methane metabolism
msub01100  Metabolic pathways
msub01120  Microbial metabolism in diverse environments
msub01200  Carbon metabolism
Module
msub_M00357  Methanogenesis, acetate => methane
msub_M00567  Methanogenesis, CO2 => methane
msub_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:msub00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    BK009_07400
Enzymes [BR:msub01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     BK009_07400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrE DUF4781
Motif
Other DBs
NCBI-ProteinID: AUB60519
UniProt: A0A2H4VQZ1
Position
complement(1547851..1548738)
Genome map
AA seq 295 aa AA seqDB search
MDPTSMIAGLGVVALMGAAATIAGAAEDLESDVGSQSNPNSQVQLAPQMGNLHRMINKAV
SGEPVAFGTWAGIAGSVAFVLMGSLQLPVIMSIAGGAAIAALVHTVYATTSHLGRIVSQS
QFNQPLFLDVVTSHLGPIAGHGFIVSFCIVGLSYLMTLSLPGFAHPFALPFLAVLWGITI
GAIGSSTGDVHYGAEREYQQYPFGGGIPVAIHGDITRNAELGARNSIDVVYFCAKFGGPV
TGFAFGLIVFLSFWTTIVFGAAGGVVAGLVIVLLLIYINNRIEVFARNKYGPYRE
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggaccctacgagtatgatcgcaggattaggtgttgttgctctaatgggtgctgccgca
accatagctggtgccgcagaggacttagagtccgatgtaggttcacagagtaaccccaac
tctcaggtacaactggcaccccagatgggcaaccttcacagaatgataaacaaggctgtt
tcaggtgaacctgtagcctttggtacatgggcaggtattgccggttctgtagcctttgtt
cttatgggatcactacaactaccagttataatgtcaatagctggaggagcagctatagca
gctttggttcacaccgtttatgccacaacatctcatttaggaaggatagtaagtcaatca
caatttaatcaaccattattcctggatgttgtaaccagtcacctgggaccaatagctggt
catggatttatcgtatctttctgtatagtaggattatcatacctgatgactttaagctta
ccaggctttgcccacccctttgcactgcccttcctggcagtactgtggggaataaccatc
ggtgccattggttcatcaacaggagacgttcactatggtgctgaaagagaataccaacag
tacccattcggtggaggtatcccagtagcaattcacggtgacataaccagaaatgcagaa
ctaggtgctcgaaactctatagatgtagtttacttctgtgccaagtttggtggacctgta
acaggatttgcctttggactcatagtattcctaagcttctggaccacaatagtctttgga
gctgctggaggagtagttgcaggtttagtgatagtcttactcttaatatacatcaacaac
cgaatcgaagtatttgccagaaacaaatacggaccatatagggaataa

DBGET integrated database retrieval system