KEGG   Meiothermus silvanus: Mesil_0116Help
Entry
Mesil_0116        CDS       T01246                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
msv  Meiothermus silvanus
Pathway
msv00010  Glycolysis / Gluconeogenesis
msv00071  Fatty acid degradation
msv00350  Tyrosine metabolism
msv00625  Chloroalkane and chloroalkene degradation
msv00626  Naphthalene degradation
msv01100  Metabolic pathways
msv01110  Biosynthesis of secondary metabolites
msv01120  Microbial metabolism in diverse environments
msv01130  Biosynthesis of antibiotics
msv01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesil_0116
  Lipid metabolism
   00071 Fatty acid degradation
    Mesil_0116
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mesil_0116
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mesil_0116
   00626 Naphthalene degradation
    Mesil_0116
Enzymes [BR:msv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mesil_0116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ADH62061
UniProt: D7BGQ7
Position
complement(121409..122392)
Genome map
AA seq 327 aa AA seqDB search
MRAMLLEAPGGPLQRAEQPPPVPGAGQVLLRVRACGVCRTDLHILDGELPAPRLPLILGH
QIVAEVAGLGPGVKRFTPGERVGVAWLGWACGACKYCQRGQENLCPQARFTGYHLDGGYA
EYTVAYADFCYPLPMGYSDLEVAPLLCAGLIGYRSLKLAGQAEHLGLYGFGAAAHILTQV
ARHQGQQVYAFTRPGDAAGQRFALELGAVWAGGSDQSPPQKLDAAILFAPDGTLVPKALR
DVDKGGTVVCGGIHMSEIPAFPYALLWEERVLRSVANLTRQDGEEFLALAPQVPIKTEVQ
AYPLEAAGQALSDLRAGKVRGAAVLAV
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgatgctgctagaagcgccaggcgggccgctgcagcgggctgagcagcccccg
cccgtgccaggagcaggccaggtgctcctacgggtacgagcctgcggggtctgccgcacc
gatcttcacatcctggacggcgaactccccgcccctcggctccccctcatcctgggccac
cagatcgtggcggaggtggccggattggggccgggggtgaagcggtttacccccggggag
cgggtaggggtggcttggctgggctgggcctgcggggcctgcaagtactgccaacggggc
caggaaaacctctgcccacaggcccgcttcaccggctaccacctcgatggcggctacgcc
gagtacacggtggcctacgccgatttctgctaccccctgccgatggggtacagcgacctc
gaggtagccccgctactatgcgcgggtctcatcggttaccgtagcctcaagctggccggc
caggccgagcacctgggcctttatggcttcggcgccgccgcccacatcctgacccaagta
gcccggcaccaaggccagcaggtctacgccttcactcggcccggcgacgctgcagggcag
cgctttgccctcgagctaggggcggtctgggccgggggctctgaccaaagcccgccacag
aagctggacgcggccatcctcttcgccccagacggaaccctggtacctaaggccctgcgg
gacgtggataaaggcggcaccgtagtctgcggcggcatccacatgagcgaaatccccgct
ttcccctacgcgcttttgtgggaggagcgggtgctgcgctcggtagccaacctgacccgc
caagatggcgaggagtttctggccttggctccgcaggtgcccattaaaaccgaggtgcag
gcttacccgctcgaggcggcaggccaggccctctccgacctgcgcgccggaaaggtacgt
ggggcggcggtgctggccgtctga

DBGET integrated database retrieval system