KEGG   Meiothermus silvanus: Mesil_1083Help
Entry
Mesil_1083        CDS       T01246                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
msv  Meiothermus silvanus
Brite
KEGG Orthology (KO) [BR:msv00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Mesil_1083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ADH62988
UniProt: D7BD70
Position
complement(1071603..1072613)
Genome map
AA seq 336 aa AA seqDB search
MPTELLVLILIVALALAFDFINGFHDTANAVATSIATRALAPLQAVLLAAAFNVLGALSG
TAVAKTVGKGIIPPELATHTLVIAALLSAIVWNLITWRYGIPSSSSHALIFSIVGAGIAE
SGIHAIKWGDGVAKALQGLVFSPFFGFLGAMLLLTLLLWLVANRRPSWVNRFFLRAQVVS
AAYMAFSHGSNDAQKTMGIITLALATYYGWSGEQFQVPLWVILSAALAMGIGTAAGGWRI
IKTIGFQAVALRPIDGFAAEVAGATVIETASRLGIPLSTTHTISSAILGAGATQRLSSVR
WTIAGRIVTAWIVTIPACIALSWLIYTLLHLLTGSR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcctaccgaactgcttgtactcatcctgatcgtggccctggccttggcctttgatttc
atcaacggctttcacgacaccgccaacgcggtcgctacctccatcgctacgcgggccctg
gcccccttacaggcggttttgctggcagcggccttcaacgtgctcggggccctctccggc
acagcagtcgccaagaccgtgggtaaggggatcatcccccccgaactggccacccatacc
ctggtgatcgcggccctcctttcggccatcgtatggaacctcatcacttggcgctatggc
atcccctcgagttcttcccacgcgctgatcttctccatcgtgggggcagggatcgccgag
agtggaatccacgcgatcaagtggggtgatggcgtggctaaagccctacaagggctggtg
ttctccccttttttcggctttttgggggcgatgctgctgctgaccctgctgctatggctg
gtagcgaaccggcgaccctcctgggtcaaccgcttctttctgcgcgctcaagtagtatcg
gcagcctatatggctttcagtcatggctccaacgacgcccagaagaccatgggcatcata
accttggccctcgccacctactacggctggagcggtgaacagttccaggttcccctatgg
gtgatcctctcggcagctttggcgatgggcatcggcactgccgccggggggtggcggatt
atcaagaccatcggtttccaggcagtagcgctcagacccatcgatggtttcgctgctgag
gtggctggggctaccgtgatcgaaaccgctagccgcttggggatccccctctccaccacc
cacaccatctcctcggccatcctgggagcaggagctacgcagcggctctcgtcagtgcgc
tggaccatcgccgggcgcatcgtgacggcctggatcgtgaccatacccgcctgtatcgct
ttgagctggctgatctacaccttgttgcacctgctcacaggaagccgctag

DBGET integrated database retrieval system