KEGG   Meiothermus silvanus: Mesil_1360Help
Entry
Mesil_1360        CDS       T01246                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
msv  Meiothermus silvanus
Pathway
msv00260  Glycine, serine and threonine metabolism
msv00750  Vitamin B6 metabolism
msv01100  Metabolic pathways
msv01110  Biosynthesis of secondary metabolites
msv01120  Microbial metabolism in diverse environments
msv01230  Biosynthesis of amino acids
Module
msv_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mesil_1360
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mesil_1360
Enzymes [BR:msv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mesil_1360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ADH63253
UniProt: D7BEL0
Position
complement(1343922..1345208)
Genome map
AA seq 428 aa AA seqDB search
MVRYFSTRDSHKTPLSFAEALLKGLAPDGGLYLPDRIPTLSPSAWLEASSLAEVGVKVLG
EWLKEEIPAADLEPIVRDALNFPCPLIPLSDGVYVLELFHGPTLSFKDFGARTMARLMQY
FLARRGERRIILVATSGDTGSAVADGFAGQDNIEVVLLYPKGKVSDVQERQLIVRRKGVR
SFAVEGSFDDCQRMVKEAFVDPQLSHLPLSSANSINIGRLLPQTLYYLWAARQLGGGAVN
FCVPSGNLGNLTGGILAALMGQDVPRFLAAHNANHFFPNFLAGRAEAYQFHPTLATLSNA
MDVGAPSNFERLYTLLGANKLRAWVWGTVVLDDATLERMRQTYARYGYIACPHTAVGLEA
VARYRAATADPTPIVTLSTAHPAKFPEAVAGALGIQAPKEAALEELWGREVAVETIPPTV
EALKQHLL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggttcgctacttcagcacccgtgactcccataaaacccccctctccttcgctgaggcc
ctgctcaaagggctcgcgccggacggagggttatacctcccggaccggattcccaccctc
agcccgagcgcctggctcgaggcgagttccctcgcggaagtcggggtgaaggtgctgggg
gagtggttgaaggaagagatccctgcggcggacctcgagcctatcgtccgcgacgcgcta
aacttcccctgcccgctgatcccgctttcggacggggtgtacgtgctcgagctgttccac
ggccccaccctctccttcaaggacttcggggcgcgcaccatggcccggctgatgcagtac
ttcctggcccgccggggcgagcggcggatcatcctggtcgccacctcgggcgataccggc
agcgccgtggcggatggctttgccggccaagacaatatcgaggtggtactgctctacccc
aagggcaaagttagcgacgtgcaagagcgccagctgatcgtgcggcgcaaaggggtgcgg
agcttcgcggtagagggcagctttgacgactgccagcgcatggtgaaagaagccttcgta
gacccccagctctcgcacctgccgctctcgagcgccaactctatcaacatcgggcggctc
ctaccacagacgctctactacctgtgggcagcccgtcagctggggggcggcgcagtcaac
ttttgcgttcctagcggcaacctcggcaacctcacgggaggcattctggccgctttgatg
ggccaagatgtaccccgcttcctcgccgcgcataacgccaaccacttcttccccaacttc
ctggcgggccgagcggaggcctaccaattccaccctaccctcgccaccctctccaacgcc
atggacgtgggcgcacccagcaacttcgagcggctgtataccttgctgggagcgaacaag
ctgcgcgcgtgggtatggggtacggtggtcttggatgacgcgacgctcgagcgaatgcgg
caaacctatgcgcggtatggctatatagcctgcccccacaccgcagtaggactcgaggcg
gtagcccgctaccgcgctgccaccgctgacccgacccctatcgtcaccctctccacggcg
caccctgccaagttcccggaagccgtcgcaggagccctcggcatccaagcccccaaggaa
gctgcgctcgaggaactgtgggggcgcgaggtcgcggtggaaaccatccccccaacagtg
gaagcgctcaaacagcacctgctatag

DBGET integrated database retrieval system