KEGG   Meiothermus silvanus: Mesil_1674Help
Entry
Mesil_1674        CDS       T01246                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine/D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
msv  Meiothermus silvanus
Pathway
msv00471  D-Glutamine and D-glutamate metabolism
msv00550  Peptidoglycan biosynthesis
msv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Mesil_1674
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Mesil_1674
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:msv01011]
    Mesil_1674
Enzymes [BR:msv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     Mesil_1674
Peptidoglycan biosynthesis and degradation proteins [BR:msv01011]
 Precursor biosynthesis
  Amino acid ligase
   Mesil_1674
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: ADH63559
UniProt: D7BFK6
Position
complement(1678914..1680185)
Genome map
AA seq 423 aa AA seqDB search
MSEVERLVFGLGRSGMGVLRFLAHHRMSARYFDEKLKEAEARAADELGFTFDDDPQPGEY
QQVIAAPGVPMDHPRLLALREGGAEIIGEAELAYRSAKTPIVGITGTAGKGTATLATAHF
LRALGFKALEGGNLDPPLLDIIEQAEVAVAELSSFQLERVVHFRPRVAVLLNLGVDHLDR
HHTLETYHAAKLNLIRNLTAEDALVYNAEDPKIVQAILHSPARKYPFHPATNPRQTNLRA
AREAAKAYASIAGKAGDERVLDEAEKTAPRLPGRFDTFAHKGDVVFIDDSIATRYDAVKA
ALQAAPAPIAWILGGRDKGAPTEGLERIVAERVRVILAIGEDGPRMAQAFRGYTELVNIQ
EPSGEATLRKAVQEGLSRLSGGSILLAPMGTSFDQFKDYKERSQVFRRVALELGAEMLEG
GTP
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagttgagcgcctggtcttcgggcttgggcgtagcgggatgggtgtgctgcgc
tttttggcccatcaccggatgagcgcccgttacttcgatgaaaagctcaaagaggccgaa
gccagggccgccgatgagctggggttcaccttcgacgacgatccccaaccaggggagtac
cagcaagtcatcgccgctcccggggtgccgatggatcacccccgccttctggcgctgcga
gaagggggcgctgagatcatcggggaggccgaactcgcctaccgcagcgcgaagaccccc
atcgtggggatcaccggaacggctggcaaagggaccgccaccctggccaccgcccatttc
ctgcgggcgctgggattcaaagcgctcgagggcggcaatctggacccgcctttgctggat
atcatcgagcaggccgaggtagcggtggccgagctttccagcttccagctcgagcgcgtc
gtacatttccgcccgcgggtggcggtgctactcaacctgggggtagaccacctggaccgg
caccataccctcgagacttaccacgccgccaagctcaacctcatccgcaacctcaccgct
gaagacgcgctggtatacaacgccgaggatcccaaaattgtccaggccatcctccattcc
ccggccaggaaataccctttccacccagcgacaaacccacgccagaccaacctgcgcgct
gcccgcgaggccgcaaaagcctatgcgtccatcgccgggaaagctggggacgagcgcgtc
ttagacgaagccgaaaagacagcccctaggcttccaggccgcttcgacaccttcgcccac
aaaggcgacgtcgtttttatcgacgactccatcgccacccgttacgacgcggtgaaagca
gccttgcaggcggccccggcccccattgcctggatcctgggcggacgggacaagggagcc
cccacggaagggctcgagcgcatcgtggcggaacgggttcgggtcatcctggccatcggc
gaggacggcccccggatggcccaggccttccgcggatacaccgagctggtgaacattcaa
gaaccctccggcgaggcgaccttgcgcaaagccgtacaagaggggctatcccggctatcg
ggcggtagcatcctcctagctccgatgggcacctccttcgaccagttcaaagactacaag
gaacgctcacaggtgtttcgccgcgtggccctcgagctgggggcagagatgttggaagga
ggtacgccatag

DBGET integrated database retrieval system