KEGG   Meiothermus silvanus: Mesil_1839Help
Entry
Mesil_1839        CDS       T01246                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
msv  Meiothermus silvanus
Pathway
msv00260  Glycine, serine and threonine metabolism
msv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
msv01100  Metabolic pathways
msv01110  Biosynthesis of secondary metabolites
msv01130  Biosynthesis of antibiotics
msv01230  Biosynthesis of amino acids
Module
msv_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mesil_1839
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mesil_1839
Enzymes [BR:msv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mesil_1839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth UPF0149
Motif
Other DBs
NCBI-ProteinID: ADH63716
UniProt: D7BG13
Position
1828400..1829191
Genome map
AA seq 263 aa AA seqDB search
MTTHEAFMRALFQGRAALIPYATAGYPDRSGFSRMVEQLLPYADLLEIGLPYSDPLGDGP
VIQRASETALRNGTTVRKVLEMVHEVRAQTDKPIYLMTYLNPVIATGPERFFHEFAQAGV
TGLILPDLPPDEDPELVDLAHAAGLSTTFLLAPTSTDARIAAVAPYCTGFVYTVSVTGVT
GVRDRLPDGLPELVGRIRQHTQVPTAIGFGISSEATARQAALAADGVVVASALIRAVEEG
RALEPVLEDIRRGLQKHSVPWPG
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccacgaagctttcatgcgagcgcttttccaaggccgggcggcgctaattccc
tacgctacggcaggctatcccgaccgcagcgggtttagccggatggtagaacagttattg
ccctatgccgatttgctcgaaatcggcctgccctattccgaccccctgggcgatggcccg
gtgattcaacgggcctctgagacggcgctcagaaacggcacgaccgtacgcaaggtgctg
gagatggtgcacgaggtacgtgcccagaccgacaaacccatatacctgatgacctacctc
aacccggttatcgccaccggccccgagcgcttcttccatgagttcgcccaggccggggtc
accggcctgatcctgcctgatcttccccccgacgaggatcctgagctggtagatctggcc
cacgcggcgggtctttccaccacctttttgctagcccccacctctaccgatgcccgcatc
gccgccgtagccccctactgtactggctttgtatacaccgtttcggtgaccggggtgacc
ggggtacgggatcggctgcccgacgggctacccgagctggtaggccgcattcgccagcac
acccaggttcctaccgccatcggtttcggcatctcgagcgaggctacggcgcgccaggct
gccctagccgccgacggagtggtggtggcgagcgccctgatccgggcagtggaagagggt
agagcgctggagccggttctagaggatatacgacggggtttgcaaaaacattctgtcccc
tggccggggtaa

DBGET integrated database retrieval system