KEGG   Meiothermus silvanus: Mesil_2480Help
Entry
Mesil_2480        CDS       T01246                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
msv  Meiothermus silvanus
Pathway
msv00030  Pentose phosphate pathway
msv00480  Glutathione metabolism
msv01100  Metabolic pathways
msv01110  Biosynthesis of secondary metabolites
msv01120  Microbial metabolism in diverse environments
msv01130  Biosynthesis of antibiotics
msv01200  Carbon metabolism
Module
msv_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
msv_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:msv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mesil_2480
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Mesil_2480
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:msv04147]
    Mesil_2480
Enzymes [BR:msv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Mesil_2480
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Mesil_2480
Exosome [BR:msv04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Mesil_2480
  Exosomal proteins of colorectal cancer cells
   Mesil_2480
  Exosomal proteins of bladder cancer cells
   Mesil_2480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ADH64333
UniProt: D7BAV9
Position
2519866..2521239
Genome map
AA seq 457 aa AA seqDB search
MIDLVIFGATGDLTRRKLLPALYQLEAAQKLPEGLRIIGVGRKLVEPGLFREQARESLEK
FEGKIDPGVWDRLSGRIGYEASDYSVESLRAMSHRLAPSVLFYLALPPDVFPTVAANLGQ
AGLSKENGGFRRLVIEKPFGHDLASALELQNQLLQHWSESQILRIDHYLGKETVQNVLVF
RFANAWLEPLWNNLHIAQVQITVAEEIGVEGRGEFYDKVGAVRDIVQNHMMQLLTLSALE
PPPKIEADLLHNEKVKVLRSIRPLSRENLVQGQYVGYLEEAGLEFSSTETFAALKLYLDN
WRWKGVPFYLRTGKKLARKHTEVALQFKGPPQRLFEDTDCNPEPGWLVLEVQPQEGMHID
VEVKTPGLQLSSRRTSLRASYRSKGLGELSAYATLILDALNGDRSLFLRFDEVEWAWRVL
EPVLRPVDPPELYAPGSIGPNNQFSLLEDGHRWRKLG
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgattgatctagtcatctttggcgcgaccggggatcttactcggcgcaagttgttgccc
gctttgtaccagctcgaggctgcccaaaaactccccgagggcctaaggatcatcggggtc
gggcgaaagctggtagagcctgggctattccgcgaacaagcccgagagagcctggagaag
ttcgaggggaagatcgatccgggggtatgggaccggctttcgggacgcattggctacgag
gcctcggattactcggtggaaagcctgcgggctatgagccaccggctggccccctcggtg
ctgttctatctggctttgccccccgacgtcttccctaccgtagctgccaatttgggtcag
gctgggctctctaaggaaaacggggggttccgccggctggtgatcgaaaagcctttcgga
cacgacctcgcgagcgccctcgagctgcaaaaccaactcctgcagcactggagcgaatct
cagatcctgcgcattgaccattacctgggtaaagagaccgtgcaaaacgtgctggtattt
cgcttcgccaacgcctggctcgagccattgtggaataacctgcacatcgcccaggtccag
atcaccgtggccgaagagatcggggtggaggggcggggcgagttttacgacaaagtgggg
gcggtgcgggacatcgtgcaaaaccacatgatgcaactccttacgctctccgccctcgag
ccaccccccaagatcgaggccgacctgttgcacaacgaaaaggtcaaggtgctgcgttcg
atccggcctttgagccgcgaaaacttggtgcagggccagtacgtgggctatctggaagaa
gcagggctcgagttctcctccaccgagaccttcgctgcccttaagctctacctggacaac
tggcgctggaaaggggtgcccttttacttgcgcaccggcaaaaagctggccaggaagcac
accgaggtagcgctgcagttcaaaggtccaccccagcggctcttcgaggacaccgactgc
aaccccgaaccgggctggttggtactcgaggttcagccccaggagggcatgcacatcgac
gtggaagtcaagaccccggggttgcagctctcctcccgcagaacttcgcttagggcgtcg
taccgttcgaaaggcctcggtgagctttcagcctacgctactttgatcctcgatgcctta
aacggcgaccgctcgctttttcttcgtttcgacgaggtggaatgggcctggcgggtgctg
gagccggtgttgcggccagtagacccccccgagctatacgcccccggaagcatcggcccc
aacaatcagttcagtttgctcgaggacggccatcgctggcgcaaactgggctag

DBGET integrated database retrieval system