KEGG   Meiothermus silvanus: Mesil_2974Help
Entry
Mesil_2974        CDS       T01246                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
msv  Meiothermus silvanus
Pathway
msv00010  Glycolysis / Gluconeogenesis
msv00052  Galactose metabolism
msv00500  Starch and sucrose metabolism
msv00520  Amino sugar and nucleotide sugar metabolism
msv00521  Streptomycin biosynthesis
msv01100  Metabolic pathways
msv01110  Biosynthesis of secondary metabolites
msv01120  Microbial metabolism in diverse environments
msv01130  Biosynthesis of antibiotics
msv01200  Carbon metabolism
Module
msv_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesil_2974
   00052 Galactose metabolism
    Mesil_2974
   00500 Starch and sucrose metabolism
    Mesil_2974
   00520 Amino sugar and nucleotide sugar metabolism
    Mesil_2974
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mesil_2974
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Mesil_2974
Enzymes [BR:msv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Mesil_2974
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FtsA BcrAD_BadFG Hexokinase_2
Motif
Other DBs
NCBI-ProteinID: ADH64812
UniProt: D7BDJ2
Position
complement(3020683..3021585)
Genome map
AA seq 300 aa AA seqDB search
MSVVGIDLGGTKIAAGVFSEGALRSKVTVATPEDGGDAVVEAMAQAARAAMREAGMAAQS
VGLGVPGPLDFKKGVIKFAPNIAGMLDFPVVAKLTATLGLPVYLENDANAAALAEHYLGA
ARGAESSLFVTVSTGIGGGFVVGGRVWRGARGQGAEVGHVTVIPQGPVCGCGLDGCLESV
AAGRALERDAGYAYNTPMTTPELFARYRAGETKATRIVHQAAHFVGIGLANFVKTFDPEV
IVVGGGVALHGGEGYMHTLMQAYERYLEGWQPAPVRLAKLGTEAGLLGAALTAAVEVGEV
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtagtagggattgacttaggcgggaccaaaatcgcagcaggggtgttcagcgaa
ggagctttacgctccaaggtcacggtggccacccctgaagatggtggggatgccgttgtg
gaagcaatggcccaggctgcccgcgctgccatgcgcgaagccgggatggcggcacagtcg
gtggggctgggggtgccggggccgctggactttaaaaagggagttatcaagtttgctccc
aacatcgcagggatgctcgactttcccgtagttgctaagctgaccgcgaccctggggctg
ccagtatatctagagaacgacgctaacgccgctgctttggccgagcactatctgggagct
gcccgaggggccgagagttccttgtttgtgacggtttctaccgggatcggtggggggttc
gtggtaggcgggcgggtctggcgcggggcgcgcggccaaggagccgaggtagggcacgtt
accgtgattccccaggggccagtgtgcggttgcggccttgatggttgcctcgagtcagtc
gcggcgggccgagccctcgaacgcgatgccgggtacgcctacaacacccccatgaccacc
cccgaactcttcgcccgttaccgagcgggggagaccaaggccacccgaatcgttcaccaa
gcagctcactttgtaggaatcggcttggcgaactttgtcaaaaccttcgaccctgaagtc
atcgtggtcggtgggggagtggcgctgcacggcggcgaggggtatatgcacacccttatg
caggcctatgaacgctacctcgagggctggcagccagccccggtgcgcctggccaagctc
ggtaccgaagctgggcttctaggagcagcgcttacggcggctgtcgaggtgggggaggtg
tag

DBGET integrated database retrieval system