KEGG   Meiothermus silvanus: Mesil_2985Help
Entry
Mesil_2985        CDS       T01246                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
msv  Meiothermus silvanus
Pathway
msv00860  Porphyrin and chlorophyll metabolism
msv01100  Metabolic pathways
msv01110  Biosynthesis of secondary metabolites
msv01120  Microbial metabolism in diverse environments
Module
msv_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mesil_2985
Enzymes [BR:msv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Mesil_2985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 SelP_N UPF0728
Motif
Other DBs
NCBI-ProteinID: ADH64823
UniProt: D7BDK3
Position
3032710..3033414
Genome map
AA seq 234 aa AA seqDB search
MTVALTHAEGRLEGLRERLETQGYRVVHYPLIATQTLQGVSLEPLEACCWWLFSSQAAVR
AVVELGGRFAGHRLGAVGEGTAKALRDLGLEVELVSPEGHAESLARAFIAWQAPGPVGLP
RGNRALPTLADLLEGAGYEVHALTVYKTLTQPWPPDAPIPDLTVLASPSAVEALPVEVAR
QTHCIALGPSTAQSLRACGLSYSQAQSPTVEGVIAAIEHATQALPRSAVPGLHG
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
gtgacggtcgccctaacccacgccgaaggacgcctggaagggttaagggaacgccttgaa
acgcaggggtatagggtggtgcactacccgctgatagctacccagaccctgcagggggta
agcctggagccgctcgaggcctgctgctggtggctcttctcgagccaggcggcggttcgg
gcggtggtggagctagggggaaggttcgcggggcaccgcctcggagcggtaggggaaggc
accgccaaggccttgcgggatctgggcctcgaggtcgagttggtgagcccggagggccac
gctgaatccctggcccgtgctttcatcgcctggcaagccccggggccggtagggctcccg
cgcgggaaccgggcgctaccgaccctggccgatctgctggagggggctgggtacgaagtg
cacgctctgacggtatacaaaaccctcacccagccctggcccccggatgcgccaatcccc
gatctcaccgtgctggcaagcccttcggcggtggaagctttgccggtggaggtagcccgg
cagacccactgcatcgccctggggccgagcaccgcgcaaagcttgcgggcctgcggcctc
agctatagccaagcccaaagccccaccgtagaaggggtgatcgcggccatcgaacacgct
acccaggccctaccccgctctgccgtccccggtttgcacggctaa

DBGET integrated database retrieval system