KEGG   Methanosarcina siciliae T4/M: MSSIT_0228Help
Entry
MSSIT_0228        CDS       T03865                                 

Definition
(GenBank) N5-methyltetrahydromethanopterin:coenzyme M methyltransferase subunit E
  KO
K00581  tetrahydromethanopterin S-methyltransferase subunit E [EC:2.1.1.86]
Organism
msw  Methanosarcina siciliae T4/M
Pathway
msw00680  Methane metabolism
msw01100  Metabolic pathways
msw01120  Microbial metabolism in diverse environments
msw01200  Carbon metabolism
Module
msw_M00357  Methanogenesis, acetate => methane
msw_M00567  Methanogenesis, CO2 => methane
msw_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:msw00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MSSIT_0228
Enzymes [BR:msw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     MSSIT_0228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrE
Motif
Other DBs
NCBI-ProteinID: AKB26947
UniProt: A0A0E3P390
Position
complement(274329..275243)
Genome map
AA seq 304 aa AA seqDB search
MEPLIGMGVLALIGVAATIAGASEDLESDVGSQSNPNSQVQLAPQMMFPHRIFNKAVSGE
PPSNALMCSVGAAVATVLISEFTLSPLFALVLGSLIAACVHGTFAVTSTMGRAASQSRFK
QPVYLDMIRSHTPVIMGYAFITTFCILVVSYLMTVVLGHPFPLTMLAFIWGITVGAIGSS
TGDVHYGAEREFQQFEFGSGLNASNSGNIVRYGESGVRDGYDNSWFCAKFGGPVTGMAFG
MTVFLGSWVTTVFDPAVSISRGWLSVVAGIIIVLILIYWNWKIEVKARSAYGPYKEDKTE
EASA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggaaccactcataggcatgggagtgctggcacttattggcgtagctgcaaccattgca
ggtgcctcagaagacctagaatccgatgtcggatcccagagtaacccgaactcacaggtc
cagttagctccccaaatgatgtttccgcacagaatatttaacaaagcggtatcaggggaa
cccccctcaaacgcattaatgtgttcggtcggtgcagccgtcgctacagtattaataagt
gaattcactttgtctcccctctttgcactggtcttgggatctcttattgcagcatgtgtc
cacggtacctttgccgtcacatctacaatgggacgcgcagccagtcagagtcgcttcaaa
cagccagtttatctggatatgatcagaagccacacccccgtaattatgggatacgctttc
ataacgactttctgtatccttgtggtgtcatatctgatgaccgttgtacttggacatccg
ttcccgctaaccatgctggcctttatctggggtattacagtaggtgcaatcggctcttcc
accggtgacgttcactacggtgcagagcgcgaattccagcagttcgagttcggttcaggg
ctcaacgcttccaactcgggaaacattgtccgatatggagaatccggggtcagggacggg
tatgataattcctggttctgtgccaagttcggaggtcctgtcacaggtatggcttttggt
atgaccgtgttccttggaagctgggttaccactgtttttgatcctgcagtaagcatttcc
agaggctggctctctgttgtcgctggtatcattattgttcttatcttaatttactggaac
tggaagattgaagtcaaagcccgtagtgcttacggaccctacaaagaagacaaaaccgag
gaggcttcagcatga

DBGET integrated database retrieval system