KEGG   Methanosarcina siciliae T4/M: MSSIT_2339Help
Entry
MSSIT_2339        CDS       T03865                                 

Definition
(GenBank) Homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
msw  Methanosarcina siciliae T4/M
Pathway
msw00270  Cysteine and methionine metabolism
msw00920  Sulfur metabolism
msw01100  Metabolic pathways
msw01110  Biosynthesis of secondary metabolites
msw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:msw00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    MSSIT_2339
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    MSSIT_2339
Enzymes [BR:msw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     MSSIT_2339
    2.3.1.46  homoserine O-succinyltransferase
     MSSIT_2339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 CBS Hydrolase_4 Esterase DUF1938 Baculo_gp64 Peptidase_S9
Motif
Other DBs
NCBI-ProteinID: AKB29058
UniProt: A0A0E3P5S3
Position
complement(2927743..2929392)
Genome map
AA seq 549 aa AA seqDB search
MVVSSVNFSGNSSKNLFSEKKGQSIGPVRSMNYEIPGTFVLESGKTLSDARIEYEIYGKM
NADKSNVILICHALTGDAHAAGFHEGEKKPGWWEIVIGPNKAFDTEKYCIICSNILGGCK
GSTGPSSIDPETGKHYGISFPVITVKDMVKVQKKLVEHLGVKQLFAVAGGSMGGMQVLQW
TVSYPEMVKKAIAIATTASTTPQQIAFGAIGRKAITDDPKWNGGDYYGKEIPSQGLALAR
MIGHITYLSDASMQKKFGRLQQDKEKSGTKACTKGITGTEGKNLSEISSEISSEISSEIS
SEIAPEFSHDFTPNFQVESYLNYKGDNFTKRFDANSYLYITKAVDYFDLARNGSLIEGFS
GVTAKYLVISISSDWLYPPYQSQEIVSALNANGIDARYEEIRSQYGHDAFLLEEGQLSYL
IRGFLSEVLVSDVMNRNFYTVSRNETIEHASKLMVKERVSHLPVISETGKIEGIVTSWDI
TKAVACKINELDEIITRDVRYVYEDERIEKASSIMEDYSISSLPVIDSEHRIIGLVTSES
ISALIGRFG
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggtggtttcttccgtaaacttttcagggaattcttccaaaaatctgttttcggaaaaa
aaaggccagagcatcgggccagtccgctcgatgaactatgaaatccccggaacctttgtg
ctcgagagcggaaaaaccctttccgacgccaggatagagtacgaaatttacggaaagatg
aacgccgataaaagcaacgttatcctgatctgccacgcccttactggagacgcccatgct
gccgggtttcatgaaggcgagaaaaaaccgggctggtgggagatcgtaatcggccccaat
aaggcgtttgacactgaaaaatactgcatcatctgctcaaacatcctgggaggctgtaaa
ggctcaacaggcccttcttcaatagaccctgaaaccggaaaacactacggcatctccttt
cccgtaattacggtcaaagacatggtaaaggtccagaaaaaactggtcgagcacctcggg
gtaaaacagctttttgcggttgcaggcggttccatgggaggaatgcaggtactccagtgg
acggtcagttaccccgaaatggtaaaaaaagcaattgcaatcgcgactacagcctccaca
accccgcagcaaatcgcattcggagcaataggcaggaaagccataaccgatgaccctaaa
tggaatgggggagactattacggaaaagagataccttcccaggggctcgcccttgcccgt
atgataggacatattacctacctgagcgacgcctccatgcagaaaaagttcggaaggctc
cagcaggataaagagaaatcaggtacaaaagcatgcacaaaaggcataacgggcacggaa
ggcaaaaatttgtccgaaatatcctctgaaatatcctctgaaatatcctctgaaatatcc
tctgagatcgctcctgaattctctcacgattttaccccaaacttccaggttgagagctac
cttaactacaagggagataatttcacaaagcgttttgatgccaattcctatctgtacatt
acaaaagctgtggactactttgaccttgcaagaaacggctcccttatagagggcttttcc
ggagttactgcaaaataccttgtaatttccatctcttcggactggctctaccctccttac
cagtcgcaggaaatcgtttcagcccttaatgcaaatggaattgatgccaggtatgaagaa
atcaggtcccagtacggacatgacgccttcctgcttgaagagggacagcttagctatctg
ataaggggtttcctctccgaagtccttgtcagcgatgtcatgaaccgtaacttctacacg
gtctcgagaaatgaaaccatcgaacacgcctcaaagctgatggtaaaagagcgcgtaagc
caccttccggtcatttcggaaaccggaaaaatcgaaggtatcgtcacctcctgggacatc
acaaaagcagtagcctgcaaaatcaatgagctggacgaaattatcacccgggatgtcagg
tacgtatacgaagacgaaaggatcgagaaggcgtcctcaataatggaggattactcgatt
tcctcactcccggtcattgattccgagcaccgcataataggtcttgttacaagcgaaagc
ataagtgcccttatcggcaggttcggttaa

DBGET integrated database retrieval system