KEGG   Marinobacter similis: AU14_00400Help
Entry
AU14_00400        CDS       T03594                                 

Definition
(GenBank) 23S rRNA methyltransferase
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
msx  Marinobacter similis
Brite
KEGG Orthology (KO) [BR:msx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:msx03009]
    AU14_00400
Enzymes [BR:msx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     AU14_00400
Ribosome biogenesis [BR:msx03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    AU14_00400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ
Motif
Other DBs
NCBI-ProteinID: AHI27691
UniProt: W5YF18
Position
82956..84032
Genome map
AA seq 358 aa AA seqDB search
MEQVVVFCRPGFETEAGRELTDRAAESGIFGFFEPQKDSGLVWFSLGGPETADDLLSRLE
LSTMVFVRDWFVVLARIPLPEHDRVGAVINGLRSLERGYPGCARLEVRLPETNADGDLGK
FARKWVSPLSRGMRGAGLLKADQKAPAPARFEVLLSEFAEAVVGFSLEENRARFVSGIPR
LRLPASAPSRSALKLEEAWKVFLPADQELDYLGGGKKAADLGAAPGGWTWQLVRQGMFVT
AVDNGPMNDELMASGQVEHVEADGYSWRPKRGIDWMVCDIVDQPRKTANLAVDWLAGGHC
RYTVFNLKLPMKKRYDEWLICRDIIHQGLKEAGLGFRLRARHLYHDREEITCFIERTG
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggaacaggttgttgtattttgtcgcccggggtttgaaaccgaggccggtcgggagctg
acagacagggccgcagagtctggcatctttggtttctttgagccgcagaaagactccgga
ctggtctggttctccctcggtgggccggagaccgcggacgacctgctgtcgcggctagag
ctgtcgacgatggtcttcgttcgagactggttcgtggtgctggcgcggattccgctgcca
gaacatgatcgagtaggggcggtgatcaatggcctgagaagccttgagcggggttatccg
ggatgcgcgcgactggaagtgaggttgccggaaaccaatgccgacggtgatcttggtaaa
ttcgcccgcaaatgggtgtcacccctgtcccgggggatgcgtggagcgggacttctgaag
gcggatcagaaggcgccggcgccagcccgttttgaagtgctgttgtcagagttcgcggag
gcggtcgtcgggttcagcctcgaagaaaaccgtgcccgtttcgtcagtggaattccccga
ctgcgcctgcctgcttctgcaccgagccgatccgcgctgaagcttgaggaagcctggaag
gtattcttgccggctgaccaggaactggattacctgggcggcggcaagaaggccgcagac
cttggcgcggccccgggtggctggacctggcagctggtgcgccagggcatgttcgtcacc
gcagtcgataacgggccaatgaatgacgagctgatggcatccggtcaggttgagcatgtt
gaagcggatggttacagctggcgtcccaagcggggcattgactggatggtatgcgatatc
gtcgatcagccgaggaaaaccgcgaacctggcggtcgattggctggccggagggcattgc
cgttacacggtgttcaatttgaaattaccgatgaaaaagcgctatgacgagtggctgatt
tgccgtgatattattcatcaggggcttaaagaggcgggcctcggcttccgattacgtgcg
cgccacctctaccacgaccgcgaagaaatcacctgctttatcgagcggaccggctag

DBGET integrated database retrieval system