KEGG   Marinobacter similis: AU14_12970Help
Entry
AU14_12970        CDS       T03594                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
msx  Marinobacter similis
Pathway
msx00071  Fatty acid degradation
msx00072  Synthesis and degradation of ketone bodies
msx00280  Valine, leucine and isoleucine degradation
msx00310  Lysine degradation
msx00362  Benzoate degradation
msx00380  Tryptophan metabolism
msx00620  Pyruvate metabolism
msx00630  Glyoxylate and dicarboxylate metabolism
msx00640  Propanoate metabolism
msx00650  Butanoate metabolism
msx00900  Terpenoid backbone biosynthesis
msx01100  Metabolic pathways
msx01110  Biosynthesis of secondary metabolites
msx01120  Microbial metabolism in diverse environments
msx01130  Biosynthesis of antibiotics
msx01200  Carbon metabolism
msx01212  Fatty acid metabolism
msx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:msx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AU14_12970
   00630 Glyoxylate and dicarboxylate metabolism
    AU14_12970
   00640 Propanoate metabolism
    AU14_12970
   00650 Butanoate metabolism
    AU14_12970
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AU14_12970
   00072 Synthesis and degradation of ketone bodies
    AU14_12970
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AU14_12970
   00310 Lysine degradation
    AU14_12970
   00380 Tryptophan metabolism
    AU14_12970
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AU14_12970
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AU14_12970
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AU14_12970
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:msx04147]
    AU14_12970
Enzymes [BR:msx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AU14_12970
Exosome [BR:msx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AU14_12970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHI29172
UniProt: W5YIW8
Position
2715603..2716943
Genome map
AA seq 446 aa AA seqDB search
MAQASKTTQSKAPTRSKKPAAQPSGVRRVAIIGGNRVPFAKSNTAYSKIGNQELLTSALR
GLVDRYGLQGQRLGEVVAGAVIKHSRDFNLTREAALSSGLAPETPAYDIQQACGTGLEAA
ILVANKIALGQIECGIAGGTDTTSDAPIGVGEGLREILLDLNRAKTLGQRLKILGRFRPG
HLVPEVPENGEPRTGMSMGDHAQVTAHEWNIAREDQDQLALESHQKLGQAYEDGFFSDLM
TPLAGLERDNILRPDTTLEKLSSLKPCFDHEQGTMTAANSTALTDGASCVLLASEEWAKA
NNLEVKAWLTFSEVAAVDFVDKKEGLLMAPAYAVPRMLEKAGLSLQDFDYFEIHEAFASQ
VLSTLKAWEDPEFCKTRLGLDQPLGSIDRSKLNVKGSSLAAGHPFAATGGRIVATLAKLL
EQKGSGRGLISICAAGGQGVTAILER
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggcacaggcatcgaaaaccacccagtcaaaggcgccgacgcgctcaaaaaagccagcg
gcacagcccagtggtgtgcgtcgtgtcgcgatcattggtggcaacagggttccgttcgcc
aagtcgaacaccgcttacagcaagatcggaaaccaggagttgttgacgtccgcgctgcgc
gggcttgtggatcgttatggtctgcaaggtcaacgtctgggtgaagtggtagccggcgcg
gtgatcaagcattcccgggatttcaatttgacccgggaagccgcattaagttctggcctg
gccccggaaacgccggcgtacgatattcaacaggcctgcggtaccgggcttgaagcagcc
atcctggtggccaacaagattgcccttggtcagatcgaatgcggtattgctggtggcacc
gacaccacctccgatgcccctattggcgtcggtgaggggctgcgtgaaatcctgttggac
ctgaatcgagccaagaccctgggccagcgcctcaagattctcggtcgtttccggcccgga
cacctggtgccggaggtgcctgaaaatggagagcctcgcaccggtatgtccatgggtgat
catgcccaggtcactgcccatgagtggaacattgcccgggaggaccaggatcagttggcg
ctggaaagccaccagaaactggggcaagcctatgaggatggattctttagcgacctgatg
acgccgttagcaggactggagcgtgacaacatccttcggccggataccacgctggagaaa
ctgtcgtcgctgaagccctgtttcgatcatgagcaaggcaccatgacagcggccaacagc
accgcgctgaccgacggcgcctcttgcgtgctgttagccagtgaggagtgggcaaaagcc
aacaatcttgaggttaaggcgtggctgacgttctcggaagtggccgcggtggactttgtc
gacaagaaagaaggcctgctgatggccccggcttacgccgtgccgcgcatgcttgagaag
gcgggtctgagtctgcaggactttgactatttcgagattcacgaagcttttgcgtcacag
gtactgtcgacacttaaggcctgggaagatccggaattctgtaagacccgcctggggctg
gaccagccgctgggcagcatcgaccgcagcaagctgaatgtgaagggtagcagtctggcg
gccgggcatccgtttgccgccaccggtggtcgcatcgtggcaaccctggcaaaactgctg
gagcaaaagggcagtggccgtggcctgatctcgatctgtgccgccggtggccagggcgtt
accgcgattctggagcgctaa

DBGET integrated database retrieval system