KEGG   Mycoplasma synoviae 53: MS53_0652Help
Entry
MS53_0652         CDS       T00261                                 

Gene name
ackA
Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
msy  Mycoplasma synoviae 53
Pathway
msy00430  Taurine and hypotaurine metabolism
msy00620  Pyruvate metabolism
msy00640  Propanoate metabolism
msy00680  Methane metabolism
msy01100  Metabolic pathways
msy01120  Microbial metabolism in diverse environments
msy01200  Carbon metabolism
Module
msy_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:msy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MS53_0652 (ackA)
   00640 Propanoate metabolism
    MS53_0652 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    MS53_0652 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    MS53_0652 (ackA)
Enzymes [BR:msy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     MS53_0652 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AAZ44059
LNCC_Brazil: MS0652
UniProt: Q4A5B2
Position
complement(756619..757812)
Genome map
AA seq 397 aa AA seqDB search
MKEKILVINAGSSSIKFNLFDKESMQSIASGLAERIGLSEGHISIKYNDEFDRYVDMKNH
ENAVDVLYKFMQEINLIKDKEEIKYIGFRVVQGADYFSSSTKLDAKVVEIIEKCSIYAPL
HNPGAVQSIKAFEKVFPKAKMSADFDTAFHTTIDRVNSSYAIDNSLVKELKIKRYGAHGI
SHYYITKKLEEILKKDKVTFVNLHIGNGGSLCAVKDSKSFDTSMGLTPLAGIMMGTRSGD
IDPSIHAFVKAQKNMSVEEFTDLLNKKSGLLGVSEVSSDMRDVRKAAREGNTQARFALDL
FAKNIVDYIAKYFNSLGGKLDAIVFTAGIGENDIATREEVVNLINFRKVKIDPEKNLEKY
SDYKLISTPDSEIKVYVIRTNEELVIAKNALKLYDQE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaaaattttagtaataaacgcaggtagttcatcaattaaatttaatttattt
gataaagagtctatgcaatcaattgctagtggacttgcagaaagaattggtctttcagaa
ggtcacattagcattaaatacaatgacgaattcgatagatacgttgacatgaaaaatcat
gaaaacgcagttgatgttttatataaatttatgcaagagataaatttaataaaagataaa
gaagaaattaaatacatcggatttagagtagttcaaggagctgattatttttcttcatca
actaagctagatgctaaagtagttgaaattattgaaaaatgttcaatttatgcgccgcta
cataaccctggtgcggttcaatctattaaggcttttgaaaaagtatttccaaaagctaaa
atgtcagctgattttgatacagcatttcatactacaattgatagagttaattcatcatat
gcaattgataattcacttgtaaaagaattaaaaatcaagcgttacggagctcatggaatt
tcgcattattacattacaaaaaaactagaagaaattcttaaaaaagacaaagttactttt
gttaatcttcacatcggtaatggtggaagtttatgtgctgttaaagattcaaaaagtttt
gacacttcaatgggactaactcctttagctggaattatgatgggaactcgtagtggggat
attgatccatcaattcacgcatttgttaaagcacaaaaaaatatgtcagtagaagaattt
accgatctacttaacaaaaaaagtggactgcttggagtttctgaagtatctagtgatatg
cgtgacgtaagaaaagcggctcgtgaaggaaatacgcaagctagatttgctcttgattta
tttgctaaaaatatagtagactacatcgctaagtatttcaatagcttaggtggtaaatta
gacgcgatagttttcaccgctggtattggcgaaaacgatattgcaaccagagaagaagtg
gttaatttaattaactttagaaaagttaaaattgaccctgaaaaaaatcttgaaaaatat
tcagattataaattgatttcaactcctgatagtgaaattaaagtttatgtaattagaact
aatgaagaattagttattgctaaaaatgcattaaaactttatgaccaagaataa

DBGET integrated database retrieval system