KEGG   Malassezia sympodialis: MSY001_0080
Entry
MSY001_0080       CDS       T06541                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
msym  Malassezia sympodialis
Pathway
msym00100  Steroid biosynthesis
msym01100  Metabolic pathways
msym01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msym00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    MSY001_0080
Enzymes [BR:msym01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     MSY001_0080
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 PEMT ICMT
Other DBs
NCBI-GeneID: 30054965
NCBI-ProteinID: XP_018738727
UniProt: M5E4P5
Position
Unknown
AA seq 253 aa
MDGLLTAAFVNSLVQAFFVYAGSFTGNKLLALGGNSGNPLFDWFIGRELNPRIGKFDIKT
FNELRPGLLLWVFLDLSYGFGFMLSVGDLAWLPFTYSLQARYLAFSPVKLGWMGIVAVLA
VQSVGYYIFRTSNVEKNDFRHGKNPKSTSEIPYFQDLQYMTTSTGSKLLVSGWWGRSRHP
NYLGDWIMAWAWCLPCGFSTPIPYFYVVYFAVLLVHRQLRDDDACKKKYGSEYVTAKEQV
LTTSTTAGTLTSV
NT seq 762 nt   +upstreamnt  +downstreamnt
atggatggtctcttgacggctgctttcgtaaactcgctggtgcaagcattctttgtttac
gcaggctctttcacagggaacaagctgcttgcccttggtggaaacagtggcaacccgttg
tttgactggttcattggtcgcgagctcaatccgcgaatcggaaaattcgatatcaagact
ttcaatgaacttcgccctggtctgctactctgggtgtttttggatctgagttatggcttc
ggatttatgctgagtgtgggcgacttggcatggttaccttttacctacagtttacaagcg
cgttatcttgcattttcgccggtcaagctgggatggatgggcatagttgctgtcctggcc
gtgcagtccgtgggctactatatcttccgcacatctaatgtcgaaaagaatgatttccga
catggcaagaacccgaaaagtacgtcagaaattccttacttccaagacctgcagtatatg
acaacctcgacaggtagtaagctgctcgtgtctggctggtggggccgcagccgtcacccc
aattacctgggcgattggatcatggcatgggcatggtgtcttccatgcggttttagcaca
cccatcccttacttctatgtcgtgtattttgcagtcctgctggtgcaccgccagctacgc
gatgatgatgcatgcaagaagaaatatggatccgagtacgtcactgccaaagagcaagta
ctgaccacatctactacagctgggacacttacatccgtctaa

DBGET integrated database retrieval system