KEGG   Methanosarcina siciliae HI350: MSSIH_0343Help
Entry
MSSIH_0343        CDS       T03864                                 

Definition
(GenBank) Threonine dehydrogenase and related Zn-dependent dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
msz  Methanosarcina siciliae HI350
Pathway
msz00625  Chloroalkane and chloroalkene degradation
msz00680  Methane metabolism
msz01100  Metabolic pathways
msz01120  Microbial metabolism in diverse environments
msz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:msz00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MSSIH_0343
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MSSIH_0343
Enzymes [BR:msz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     MSSIH_0343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc AlaDh_PNT_C Glu_dehyd_C HI0933_like Pyr_redox_2 UDPG_MGDP_dh_N NAD_binding_7 PALP
Motif
Other DBs
NCBI-ProteinID: AKB31033
UniProt: A0A0E3PA82
Position
407819..409003
Genome map
AA seq 394 aa AA seqDB search
MKAVVYKGPKNVDVEEVKKPEIEKPTDVIIKVTSSGICGSDLHLYDGHGPDGLGTILGHE
PMGVVEEVGDAVELVKPGDRVVIPFNVACGSCLNCVKGLTNMCLTMNPDAAIANYGYPGA
GPYDGGQAEYLRVPYGDWACLKLPGEPGDEFEDDFVMLADIFPTAYYAAELAKVKTGKTV
AVFGAGPVGLLAAYSSMLMGASEVYVVDKSDKRLKLAESIGAVPINFTDGDPVEMIMQIR
QNDKNLMSSLRPGEEKVLGVDCAIDAVGYQALDRNNSEEFKPNQVLMDIARIIAPGGSIG
VIGVYSPDPAGKDENEKQGYLTLPWAEFWFKGVSIGTGPTPVKQMHVFLRNLIFNGKAKP
SFIVSDRIGIDEAPEAYKQFDKRDDVVKPIIKFH
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtggtatataaaggaccaaaaaatgtagatgttgaagaagttaaaaaacca
gaaatagagaagccaactgacgtaattataaaagtgacaagtagtggaatctgtggaagt
gatttacatctatatgatggccatggtcctgacggattaggaacaattttaggacatgaa
ccaatgggagttgttgaagaggttggagatgcagttgagctagttaaacctggtgatagg
gtagtaataccatttaatgttgcttgtggatcttgtttaaattgcgttaagggtttgacc
aatatgtgtcttaccatgaatccagacgcagctatagcaaactatggatatcctggagcg
ggaccatatgatggtggacaagctgagtatctgagagttccttatggagattgggcttgc
ttaaaattgcccggtgagccgggggatgaatttgaagacgattttgtgatgcttgcagat
atatttccaacagcatattatgcagcagagttagctaaagtaaaaactgggaaaacagta
gccgtttttggtgccgggcctgtaggtctacttgcagcatacagttcaatgttaatgggt
gcaagtgaagtctacgttgttgataaatctgataaacgtttaaaacttgctgaatcaatt
ggtgcagttccaattaactttacagatggtgatcccgttgagatgataatgcaaatccgt
caaaatgacaaaaatttaatgagttctctaaggcctggagaagaaaaggttttaggcgtg
gattgtgcaattgatgcggtgggttatcaagcacttgatagaaataattctgaagaattt
aagccaaaccaagttttaatggacatcgcaagaattatagccccagggggcagcattgga
gtaattggtgtttatagtccagatcctgccggtaaggatgagaatgaaaaacaaggatat
ttaacgcttccgtgggctgaattctggttcaaaggagtatccataggtactggaccgaca
cctgttaaacaaatgcacgtgtttttaagaaatttgatattcaatggtaaagcaaaacca
agcttcatagtatctgaccgtatcggcattgatgaagctcctgaggcatataagcaattt
gataagagggatgatgtagttaagcctataatcaaattccattaa

DBGET integrated database retrieval system