KEGG   Methanosarcina siciliae HI350: MSSIH_1494Help
Entry
MSSIH_1494        CDS       T03864                                 

Definition
(GenBank) Digeranylgeranylglycerophospholipid reductase
  KO
K17830  digeranylgeranylglycerophospholipid reductase [EC:1.3.1.101 1.3.7.11]
Organism
msz  Methanosarcina siciliae HI350
Pathway
msz00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:msz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MSSIH_1494
Enzymes [BR:msz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.101  2,3-bis-O-geranylgeranyl-sn-glycerol 1-phosphate reductase [NAD(P)H]
     MSSIH_1494
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.11  2,3-bis-O-geranylgeranyl-sn-glycero-phospholipid reductase
     MSSIH_1494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 FAD_binding_2 FAD_oxidored DAO Lycopene_cycl Pyr_redox_2 HI0933_like NAD_binding_8 GIDA Trp_halogenase Thi4 Pyr_redox_3 AlaDh_PNT_C 3HCDH_N Pyr_redox SE NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AKB32184
UniProt: A0A0E3PED2
Position
complement(1865752..1866975)
Genome map
AA seq 407 aa AA seqDB search
MKDSYDVLVIGAGPAGSIAAKTAAEKGLDVLLIEKRQEIGDPVRCAEGVNKEYLKKHVEI
DESWICADLKGSRIYSPNGTKVEMAEEISGGEVGYVLERKIFDRALAEHAAKAGAEVRVK
TRATGLIIEDDFVKGARLMHLGKEYEVRAKIVIGADGVESKVGRWAGIDTSLKPIDIETC
SQYLIAGVDIDPEYCEFYIGNEIAPGGYVWIFPKGGGKANVGIGILGNRTGKFKPRPVDY
LNNFVEKKFPNARIVEMIFGGVPVSGSIEKTSSNGLMLVGDAARQSDPITGGGILNAMDA
GKIAGEASYEAISAGDVSLEKLEEVYEKRWRETTGHDIDMSLIVKNCFINLKDEDLDALA
DSLKEVKFESMRLFDLLQALFKANKKLLWDLRVLFKDVAKEAMKNRT
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatagctatgatgttctcgtgataggagccgggcctgcaggttccattgctgca
aaaacggcagctgaaaaagggcttgatgtgcttttaatcgaaaagcgccaggaaataggc
gaccctgtacgctgtgccgaaggcgtaaacaaagaatatctcaaaaaacacgttgaaatt
gacgaaagctggatctgcgccgaccttaaaggttcccgtatttactccccaaacggcacc
aaggtcgaaatggcagaagaaatctccggtggagaggtgggttatgtccttgaaagaaaa
atatttgaccgtgccctcgctgagcatgctgcaaaagccggagcagaggttagggtaaag
acaagggcaacaggcctgatcattgaagacgatttcgtgaagggagcaaggctcatgcac
ctgggaaaagagtatgaagtaagggcaaaaatagtcataggtgcagacggagtcgagtcc
aaggtaggcaggtgggcaggaatagatacctctctgaagcccatagacatagaaacctgc
tcccagtaccttatagcaggcgtggacatagatccggaatactgcgaattttacatcgga
aatgagattgcccccgggggatacgtctggatcttccctaaggggggagggaaagccaat
gtgggaataggaattctgggaaacagaacaggtaaattcaaacccagacctgtcgattac
ctcaataatttcgtagagaaaaagttccccaacgccaggattgtagaaatgatcttcgga
ggagttccggtttcgggaagcattgaaaaaacttcctcaaacggcttaatgcttgtcgga
gatgcggcccgccagtccgaccctattacaggcggtggaatcctcaatgcaatggatgca
ggaaagattgccggagaagcctcttacgaagccatctccgcaggagatgtttcccttgaa
aaacttgaagaagtttatgaaaaacgctggagggaaactaccgggcatgacatagacatg
agcctcatcgtaaagaattgttttatcaacctcaaggacgaggacctggacgcccttgcc
gattctctcaaggaagtaaagttcgagagcatgaggctttttgacctactgcaggccctc
ttcaaagccaacaaaaaactgctctgggaccttcgcgtacttttcaaggacgtagcaaaa
gaagcgatgaagaacagaacataa

DBGET integrated database retrieval system