KEGG   Methanosarcina siciliae HI350: MSSIH_2234Help
Entry
MSSIH_2234        CDS       T03864                                 

Definition
(GenBank) Tetrahydromethanopterin S-methyltransferase subunit A 1
  KO
K00577  tetrahydromethanopterin S-methyltransferase subunit A [EC:2.1.1.86]
Organism
msz  Methanosarcina siciliae HI350
Pathway
msz00680  Methane metabolism
msz01100  Metabolic pathways
msz01120  Microbial metabolism in diverse environments
msz01200  Carbon metabolism
Module
msz_M00357  Methanogenesis, acetate => methane
msz_M00567  Methanogenesis, CO2 => methane
msz_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:msz00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MSSIH_2234
Enzymes [BR:msz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     MSSIH_2234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrA
Motif
Other DBs
NCBI-ProteinID: AKB32924
UniProt: A0A0E3PE87
Position
complement(2803683..2804123)
Genome map
AA seq 146 aa AA seqDB search
MEKIIVNVISNSNIRYVLVCGTESRGHLAGHSLLAIHANGIDEKGRIIGSQGAIPFIENI
SREAIERFQKQVTLLDRIGLNNSEEIRQIVEDYRDRGEVYPEETMVVCAPKKKKASFAVP
ASGDVIISGELVMDSRAGIICLAEKL
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaaaataatcgtgaacgtaatctcaaactccaatatccggtatgtgctcgtctgc
gggaccgagtcaaggggccatctggcaggccattccctgcttgcaatccatgcaaacggg
attgatgaaaaaggcaggattatagggtcgcagggagcaattccctttatagaaaatatc
tccagagaggcaatcgaacgcttccagaagcaggttacactccttgacagaataggtttg
aacaactccgaagagatccggcagattgttgaggattacagggataggggcgaagtatac
cctgaagaaacaatggttgtctgtgctccgaaaaagaagaaggcttcttttgcagttcct
gcttctggagatgtgataatctctggagaacttgtaatggattcaagggcaggaattatc
tgtctggcagaaaaactctga

DBGET integrated database retrieval system