KEGG   Moorella thermoacetica: Moth_0002Help
Entry
Moth_0002         CDS       T00308                                 

Gene name
dnaA
Definition
(RefSeq) chromosomal replication initiation protein
  KO
K02313  chromosomal replication initiator protein
Organism
mta  Moorella thermoacetica
Pathway
mta02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Moth_0002 (dnaA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mta03032]
    Moth_0002 (dnaA)
   03036 Chromosome and associated proteins [BR:mta03036]
    Moth_0002 (dnaA)
DNA replication proteins [BR:mta03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    Moth_0002 (dnaA)
Chromosome and associated proteins [BR:mta03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    Moth_0002 (dnaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DnaA Bac_DnaA_C IstB_IS21 DnaA_N AAA AFG1_ATPase AAA_22 ATPase_2 RNA_helicase DNA_pol3_a_NII AAA_16 AAA_24 AAA_7 DUF815 AAA_28 NB-ARC
Motif
Other DBs
NCBI-GeneID: 3831312
NCBI-ProteinID: YP_428885
UniProt: Q2RMJ7
Position
450..1778
Genome map
AA seq 442 aa AA seqDB search
MAPVQLDLAWQQALTILEKQVSTPALETWFYEARPVTMQGNTLVLAVANEFARDYIQSRY
YPLIQEALQQVLGRKIIKIQVICFPLSSSNQRQEPELEDPSLPPLNPKYTFETFVVGNSN
RFAHAACLAVAESPASSYNPLFIYGGVGLGKTHLMQAIGHRVRQHLPELRVMYISSEKFT
NDLINAIKDKATEQFRTKYRNIDVLLIDDIQFLAKKESTQEEFFHTFNHLYEANKQIIIS
SDRPPKEIPTLEDRLRSRFEWGLITDIQPPDLETRMAILRKKAVAEGINLPDEVMFFIAQ
KIDSNIRELEGALIRVAAYANFTKKEITPGLAEEILKDVLDLARPKPITIRLIQETVANY
FNLKVEDLKAKKRTRSVAYPRQIAMYLCRELTESSLPDIGKEFGGRDHTTVLHAYDKIRD
DLNTDPSLPQVIAQIRQQLRNQ
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
ttggctcctgtacagctcgatctggcctggcaacaggccttaacgattctcgaaaaacag
gtcagcacccctgccctggaaacatggttttacgaagcccggccggttaccatgcagggc
aataccctggtcctggctgtagccaacgaatttgcccgggactacatccagagccgctat
tatccccttatccaggaagcactgcaacaggtcctggggcgaaaaattatcaaaatccag
gtaatctgcttccctctctcaagttcaaaccagcgccaggaaccggaactggaggatccc
agtctcccccccctcaaccctaaatatacctttgaaacctttgttgtgggtaacagcaac
cgttttgcccatgcagcctgcctggccgtagccgaatcgccagccagttcttataatccg
ctatttatctacgggggcgtaggtcttggcaaaacccacctgatgcaggccatcggccat
cgggttcgccagcatttaccagaactccgggtaatgtacatctcttcggaaaaattcacg
aacgacttgattaatgctattaaggataaggctacagaacagttccgcaccaagtatcgc
aatatcgatgttttattaattgatgatatccaatttttagcaaaaaaagagagtacccag
gaagagttcttccatacttttaatcatttatatgaggcaaataaacaaataatcatctcc
agtgaccggccgcccaaggaaattcccaccctggaagaccgcctgcgttcccgcttcgag
tggggcctgatcaccgatatccaaccgcctgatctggaaaccaggatggctattttacgc
aaaaaagctgttgccgagggtattaacctgccggatgaagtcatgttctttatagctcaa
aaaattgattctaacattcgagagctggagggggccctcatccgggttgctgcttacgcc
aattttaccaaaaaagaaataacccccgggctggcagaagagattttaaaagacgttctc
gacctggcgcgacctaaaccgattaccattcgtttaatccaggagacagtagctaattac
ttcaatttgaaggtagaagatctaaaagccaagaagcgcacgcgttccgtggcttacccc
cgtcaaattgccatgtacctctgtcgggaactaaccgaatcctccctgccggatatcggt
aaggaatttggcggccgggatcatactactgttctccacgcctacgacaagattcgcgac
gacctaaacacagatccttcccttccccaggtaatagcccagataaggcaacagcttaga
aaccagtaa

DBGET integrated database retrieval system