KEGG   Moorella thermoacetica: Moth_0154Help
Entry
Moth_0154         CDS       T00308                                 

Definition
(RefSeq) aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
mta  Moorella thermoacetica
Pathway
mta00030  Pentose phosphate pathway
mta01100  Metabolic pathways
mta01120  Microbial metabolism in diverse environments
mta01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mta00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Moth_0154
Enzymes [BR:mta01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Moth_0154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-GeneID: 3831866
NCBI-ProteinID: YP_429035
UniProt: Q2RM47
Position
154142..156037
Genome map
AA seq 631 aa AA seqDB search
MYGYCGRVLRIDLTAERITIEPLPREWARNYLGGRGLNIKRLYTEVPREADPLGPENKLI
IGVGPLNGTFFPGAARVNFTARSPQTGILGDSNAGGFFGPELKYAGFDQVILEGQAGRPV
YIFIHDGFAEIKSAGHLRGLDVWQTQAAIRQELGDSRVQVAAIGPAAENGVRFAGIFCNL
VRAAARTGMGTVLASKGVKAIAVRGRQPLALADPRGFADLVQAIDREIYDHWEYQTRVLL
GTTKLVHALNEAGCLATRHFTTGRFEAAEDVSGERLAETVKLKSKACFACTIPCSRFFRI
KEGPYRGLASEGPEFEGLAGFSSRVGNPDLDFALQAVDCCNRLGMDVITTSEVISFVMEL
YARGMLTSSEADGLDLTWGNKETILSLINKIARREGFGDILADGVRAAARRLGKGEDLAM
HIKGLEVFQADPRGLKGYALGLAVASRGGDHLRSEPSFEFYEDPEAGRRRFGAPEAAFRL
EYKGKGRVVKYYEERCALADSLNACKNTLVNMEILPYEQAAALLRAAVGWDYTPEELRQI
GERIVNLERAYIVSLGIRRADDTLPRRFLEEPLPEGSGPSTGQVVELEPMLDEYYTARGW
NRDTGIPEPEKLAALGLQEALADLRSRGILP
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
gtgtatggctactgtggccgtgtcttgcggattgatttaacggctgaacgtattacgata
gagcccttaccccgggagtgggctcgtaattacctggggggacgggggttaaatattaaa
cgcctctataccgaggtaccaagggaggcagaccccctgggcccggagaataaactcatt
atcggcgtcggccctttaaacggcacttttttccccggggcggcccgggtaaactttacc
gcccgctcaccccagacgggtattctgggggattccaatgccggcggcttctttggcccc
gaattaaaatatgccggttttgaccaggtcatcctggaaggccaggccggcaggccggtt
tatatcttcatccatgacggctttgccgagatcaaatcggcaggacacctccggggcctg
gacgtctggcagacccaggctgccatccggcaggaactgggggacagccgggtccaggta
gctgccatcggcccggcagcggagaacggtgtccgctttgcgggcatcttctgtaacctg
gtgcgggcggcggcccggaccggcatgggtaccgtcctggccagcaagggagtaaaagct
attgccgtccggggacggcagcccctggccctggccgacccccgggggtttgccgacctg
gtgcaggccattgaccgggaaatatacgaccattgggaataccagacccgggtcctcctg
ggaacgaccaagctggttcatgccctcaacgaagccggttgcctggccacccgccatttt
acgactggccgctttgaagcagccgaagacgtcagcggcgagcgcctggccgaaaccgta
aagctaaaatctaaagcctgttttgcctgcaccataccctgcagtcgctttttccggatc
aaggaaggcccctaccggggcttggccagtgaagggccggagtttgaaggcctggccggt
ttttcctcccgggtgggcaacccggacctggattttgccttgcaggcagttgattgctgc
aaccgcctggggatggatgtcataactacgtcggaggttatttcctttgtcatggagctt
tacgctcgggggatgctcacctcctcagaagccgacggcctggacctaacctggggcaac
aaggaaaccatcctgagtttaatcaacaagattgcccggcgggaaggctttggcgacatc
ctggccgacggcgtgcgggcggcggcccgtcgcctggggaagggtgaagacctggccatg
catataaaggggctggaggtcttccaggccgatccccggggattaaagggctatgccctg
ggcctggcggtagccagccgcggcggcgatcacctgcgctcggaaccctcctttgaattc
tatgaggacccggaagctggccggcgccgcttcggcgcgccggaggccgccttccgcctg
gaatacaagggtaaagggcgggtggtcaaatactacgaagagcgctgcgccctggccgac
agcctgaacgcctgtaaaaataccctggtgaatatggagatccttccctatgaacaggcg
gcggccctcctcagggcagccgtagggtgggactacactcccgaagagctccggcagata
ggggaacggatcgtcaacctggaacgggcttatatagtcagcctgggcatccggcgggcc
gacgacactctgccccggcgcttcctggaagaacccctaccggagggcagcggtccctcc
acaggtcaggtggtggagctggagcccatgctggatgaatactataccgcccgaggctgg
aaccgggatacaggcattcctgagccggaaaagctggcagccctgggactgcaggaagcc
cttgccgacctccgcagccggggtatcctgccatga

DBGET integrated database retrieval system