KEGG   Moorella thermoacetica: Moth_0264Help
Entry
Moth_0264         CDS       T00308                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mta  Moorella thermoacetica
Pathway
mta00010  Glycolysis / Gluconeogenesis
mta00051  Fructose and mannose metabolism
mta01100  Metabolic pathways
mta01110  Biosynthesis of secondary metabolites
mta01120  Microbial metabolism in diverse environments
mta01130  Biosynthesis of antibiotics
mta01200  Carbon metabolism
mta01230  Biosynthesis of amino acids
Module
mta_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mta_M00002  Glycolysis, core module involving three-carbon compounds
mta_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Moth_0264
   00051 Fructose and mannose metabolism
    Moth_0264
   00562 Inositol phosphate metabolism
    Moth_0264
Enzymes [BR:mta01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Moth_0264
Exosome [BR:mta04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Moth_0264
  Exosomal proteins of bladder cancer cells
   Moth_0264
  Exosomal proteins of melanoma cells
   Moth_0264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 3833078
NCBI-ProteinID: YP_429142
UniProt: Q2RLU0
Position
272688..273437
Genome map
AA seq 249 aa AA seqDB search
MRRPIIAGNWKMHNTTEEARDLVTLLRPLVGTARAEVVVCPPFTAIAATVNAASGSNISV
GAQDLFWEDKGAYTGEVSGPMLRDLGCRYVIIGHSERRQYFGETDATVNKKLLAAYRNEL
LPIVCVGETLAEREAGHTLEVVGRQVREGLKGLETGQARDLVVAYEPVWAIGTGKTATAA
DAQEVIAFIRKTLGEMYGETAAAIRIQYGGSVKPENIAELMAQPDIDGALVGGASLDAVS
FAAIVNYDQ
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
ttgcgccgaccaattattgccggcaactggaagatgcataatacaacggaagaggcccgg
gatttggtcaccctgctgcggcccctggtaggtacggcccgggcggaggtagtggtctgc
ccgccttttacggccatagcggccacagttaacgccgcctccgggtccaacatctccgtt
ggtgcccaggacctcttctgggaggataagggggcctacaccggcgaggtttccgggccc
atgctgcgggaccttggctgccgttatgtcatcatcggccactccgaacggcgccagtat
ttcggcgagactgatgccacagtgaataaaaagctcctggctgcctaccgcaatgaattg
ctccccatcgtctgcgtcggtgaaaccctggcggagagggaggccggccacaccctggag
gttgtcggccgccaggtccgggaagggttaaagggcctggaaaccggccaggcccgggat
ctggttgtcgcctacgagcccgtctgggccattggcaccggcaagacagctacggccgcc
gacgcccaggaggttatcgcctttatccgtaaaaccctcggagagatgtacggcgaaaca
gccgcggcaatcaggatccagtacggcggcagcgtcaagccggagaatattgccgagctc
atggcccagcccgatatcgacggtgccctggtgggcggggccagcctggatgccgtttcc
ttcgccgccattgttaattacgatcaatag

DBGET integrated database retrieval system