KEGG   Moorella thermoacetica: Moth_0379Help
Entry
Moth_0379         CDS       T00308                                 

Definition
(RefSeq) ketoisovalerate ferredoxin oxidoreductase subunit beta
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
mta  Moorella thermoacetica
Pathway
mta00010  Glycolysis / Gluconeogenesis
mta00020  Citrate cycle (TCA cycle)
mta00620  Pyruvate metabolism
mta00633  Nitrotoluene degradation
mta00640  Propanoate metabolism
mta00650  Butanoate metabolism
mta00680  Methane metabolism
mta00720  Carbon fixation pathways in prokaryotes
mta01100  Metabolic pathways
mta01120  Microbial metabolism in diverse environments
mta01130  Biosynthesis of antibiotics
mta01200  Carbon metabolism
Module
mta_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Moth_0379
   00020 Citrate cycle (TCA cycle)
    Moth_0379
   00620 Pyruvate metabolism
    Moth_0379
   00640 Propanoate metabolism
    Moth_0379
   00650 Butanoate metabolism
    Moth_0379
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Moth_0379
   00680 Methane metabolism
    Moth_0379
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Moth_0379
Enzymes [BR:mta01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Moth_0379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C E1_dh DXP_synthase_N
Motif
Other DBs
NCBI-GeneID: 3832623
NCBI-ProteinID: YP_429256
UniProt: Q2RLH6
Position
382893..383759
Genome map
AA seq 288 aa AA seqDB search
MRTEAKGLVAHGVSTCHGCGMELAVRNILDVLGPRTIIVIPPGCAALFSGFGSETALKIA
GIQGNLENSAAIAAGIRAGLEMQGKDDVTVLALAGDGATVDIGIQSLSGAMERGDRILYV
CYDNEAYMNTGIQASGSTPMQAWTTTTPAKKHVYRKDMLQIARAHRIPYVASASIGYIED
LRKKIARARDAGGPAYVHLQTPCPTGWGYDPARTIEVARLAVQTRCWPLYEIIEGRINIT
VKVNKPRPVEDYLVLQRRFRGIGAEEVERIQRVVDEEYTELLERVEEE
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagaaccgaggcaaaaggcttggtagctcacggtgtaagtacatgccatggttgcggt
atggaattggcagttagaaacatcttggatgtactggggccgcgtacaattattgttata
cctccggggtgcgctgctcttttttccgggttcggtagtgaaacggctctaaagattgcc
ggtattcaaggtaaccttgaaaacagtgctgcaattgctgcaggaataagagccggtctt
gaaatgcagggcaaagacgatgttacggtcctggctttggccggtgatggtgctactgtt
gatataggcatacaatctctttcgggagccatggaacgtggggatcgtatcctatatgtc
tgttatgataacgaggcttatatgaatacaggcattcaggccagtggctctacccccatg
caagcctggactaccactactccggctaaaaagcatgtatatagaaaggatatgcttcaa
attgccagggcgcacaggatcccctatgtggccagcgcttccataggctatatcgaagat
cttcgcaaaaagattgcccgggctagagacgcaggagggccagcttatgtacatttacag
acaccctgccctaccggatggggctatgaccctgcaagaactattgaagtagcacgcctg
gcggtacagaccagatgctggccgctgtacgaaattattgaaggtcgtataaatattacc
gtcaaagtgaataaaccccgaccggtagaggattatcttgttttacagcgccggtttaga
gggataggcgcagaagaagttgagcgcatacaaagagttgttgatgaggagtacacggag
cttttggaaagggtggaggaagagtga

DBGET integrated database retrieval system