KEGG   Moorella thermoacetica: Moth_0397Help
Entry
Moth_0397         CDS       T00308                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mta  Moorella thermoacetica
Pathway
mta00020  Citrate cycle (TCA cycle)
mta00640  Propanoate metabolism
mta00660  C5-Branched dibasic acid metabolism
mta00720  Carbon fixation pathways in prokaryotes
mta01100  Metabolic pathways
mta01110  Biosynthesis of secondary metabolites
mta01120  Microbial metabolism in diverse environments
mta01130  Biosynthesis of antibiotics
mta01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mta00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Moth_0397
   00640 Propanoate metabolism
    Moth_0397
   00660 C5-Branched dibasic acid metabolism
    Moth_0397
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Moth_0397
Enzymes [BR:mta01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Moth_0397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp Citrate_bind
Motif
Other DBs
NCBI-GeneID: 3832337
NCBI-ProteinID: YP_429274
UniProt: Q2RLF8
Position
402921..404174
Genome map
AA seq 417 aa AA seqDB search
MAKLLEYQGKEWLRKAGIPVPAGRAASTPEEARQIAAELGKPVAVKAQVQAGGRGKSGAV
KLVNTPEEARAAAASILGTQIKGYPVRQVLVEEKLDIAHEYYVTIIVNSARDARCPMLMF
STEGGMDIESVPEEKIFKLHISPLFGLEVYDAVDLLVKAGIPNDQLMNFANFLVKFWGAY
KKYDCFTLETNPLVMTASGDLVAADCKMDVDNSSVYRHPEMGIEIARDLGHEPTELDVIG
WGIEKTDLRGSGFVMSMGFDEKSPGYIGYHPIGGGSAMMGMDALNNVNLKPANYADTSGN
PVASKIYRVAKVILSQPNIDGYLLGGFMMANQEQWHHAHAVVKVLREILPKKPGLPCVLL
LCGNKEEESLAILREGLKDVEGATRVEIYGREHVTDTDFIGQRLLALVKEYQEEKRK
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggctaaattgttggaatatcaggggaaggaatggctcaggaaagccggtataccggtg
cctgcaggccgggcagcttcaactccggaggaagccaggcaaattgccgccgaattggga
aaacctgtagctgtcaaggcccaggtccaggctggcggcaggggtaaatctggcgctgta
aagttagtcaatactcccgaggaagcccgggccgcagccgcctctatccttggtacccag
ataaaagggtacccggtccggcaggtgctggtcgaggaaaaactagatattgcccacgag
tattatgtgaccataattgttaattccgcccgggatgccaggtgcccgatgctgatgttc
agcacggaaggcggtatggatattgaaagcgttccggaggaaaagatctttaagctgcac
atctctcccctttttggcctggaggtatacgatgcggtagatttgctcgttaaagccggc
atccccaatgaccagctaatgaatttcgccaacttcctggtgaaattctggggtgcctat
aaaaaatacgactgctttaccctggaaacaaatcccctggtcatgacagccagtggcgac
ctggtagcggctgactgcaagatggatgtcgacaacagcagcgtctaccgccacccggaa
atgggcatcgagatcgcccgcgacctggggcatgaacccacggaactggatgtcatcggc
tggggcatagaaaagaccgacctcaggggctcgggcttcgtcatgagtatgggctttgat
gagaagagcccaggctatatcggctaccatcccattggcggcggctcggctatgatgggt
atggacgccctgaataatgtcaacctgaaacctgccaattatgccgataccagcggtaac
cccgtcgcttccaagatttatcgcgttgccaaagtaatcctctcccaaccgaacatcgat
ggctacctcctggggggctttatgatggccaaccaggaacagtggcaccacgcccatgcg
gtagtcaaagtcctgcgtgagattctccccaagaaacctggcctgccctgcgtattactc
ctatgcggtaataaagaagaagagtccctggcaattcttcgcgaaggcttaaaagacgtg
gaaggtgccaccagagtagagatctatggtcgggagcacgtgaccgacacggacttcatc
ggccagaggctgctggctctggtcaaggaatatcaagaagagaagcgaaagtag

DBGET integrated database retrieval system