KEGG   Moorella thermoacetica ATCC 39073: Moth_0455Help
Entry
Moth_0455         CDS       T00308                                 

Definition
(RefSeq) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
mta  Moorella thermoacetica ATCC 39073
Pathway
mta00564  Glycerophospholipid metabolism
mta01100  Metabolic pathways
mta01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mta00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Moth_0455
Enzymes [BR:mta01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     Moth_0455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase Peptidase_M23
Motif
Other DBs
NCBI-GeneID: 3830883
NCBI-ProteinID: YP_429329
UniProt: Q2RLA3
Position
457754..458518
Genome map
AA seq 254 aa AA seqDB search
MVTFSMALAILPALFVGLNLLKILLLLAAVITAIMWFLRRVWFYRDPVRVPPTEAGTILA
PADGKVVYIKPFRNGEVVAEKLGQAIPVREIMKAPGLGDRGWIMGIYMSPLDVHFNYAPI
AGRVEDMVHTRARVNLPMVDLWEYIRLTYFRRAVDLFCHRYRLVNERLTIFLDGEGIKIA
MVEIADKFVNKINSFIKPGQVVDRGQKVSFIERGSQVDLVIFSEDVEFTVRVGQQVYGAR
TVVARYRPPGGVVP
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggtaactttttctatggccctggcaatcctgcccgcgctcttcgtgggtttaaacctt
ttaaagatccttctcctcctggcggctgttatcaccgccattatgtggtttttgcgccgg
gtatggttctaccgcgacccggtccgggtgcctccaacagaagcgggcaccatcctggcc
ccggccgacggcaaggtagtttacatcaagcctttccgtaacggcgaggtggtggccgaa
aagctgggccaggccatccctgtccgggaaataatgaaagcaccgggcctgggcgaccgg
ggctggatcatggggatttatatgtcgcccctggatgtccactttaattacgcccccatt
gccggtagggtggaggatatggtccatacccgggccagggttaatctgcctatggtggat
ctctgggaatacatccgcttgacctacttccggagggcggtggacctcttttgccaccgc
taccgcctggtaaatgagcgcttgaccatctttctggatggtgagggcattaagatagct
atggtggagatagccgataagtttgtcaacaagataaatagtttcatcaagccgggccag
gtagtcgaccggggccagaaggtatcctttatcgagcgaggttcccaggtggacctggtt
atctttagcgaggacgttgagtttaccgtccgggtgggacagcaggtatacggcgccagg
acggtagtggctcgctaccggcctccgggcggggtggtgccttga

DBGET integrated database retrieval system