KEGG   Moorella thermoacetica: Moth_0832Help
Entry
Moth_0832         CDS       T00308                                 

Definition
(RefSeq) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mta  Moorella thermoacetica
Pathway
mta00010  Glycolysis / Gluconeogenesis
mta00052  Galactose metabolism
mta00500  Starch and sucrose metabolism
mta00520  Amino sugar and nucleotide sugar metabolism
mta00521  Streptomycin biosynthesis
mta01100  Metabolic pathways
mta01110  Biosynthesis of secondary metabolites
mta01120  Microbial metabolism in diverse environments
mta01130  Biosynthesis of antibiotics
mta01200  Carbon metabolism
Module
mta_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Moth_0832
   00052 Galactose metabolism
    Moth_0832
   00500 Starch and sucrose metabolism
    Moth_0832
   00520 Amino sugar and nucleotide sugar metabolism
    Moth_0832
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Moth_0832
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Moth_0832
Enzymes [BR:mta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Moth_0832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-GeneID: 3831529
NCBI-ProteinID: YP_429692
UniProt: Q2RK90
Position
862831..863778
Genome map
AA seq 315 aa AA seqDB search
MCLLGIDLGGTSIKAGLVDINGKILKKGQVPTGAGEGTTAVLKRIKNLARDLAGEQGLAL
GELEGIGIGIPGSVDVARGLVHLAPNLFWRDFSLRDELAALLDLPVAIENDAHVAALGEM
WQGAGRGYTSLLMVTIGTGIGSGLIIDGRVHHGLFGYGAEMGHIKMVCDGRQCHCGGHGC
LETLASATAMVKSFREYLAAGYPSMLSDRPELGAKEILAAAAGGDELAGRVIDEAACYLG
TALANAVLLVGPEAIIIGGGPAQAGEVILDPIRKHLAAAMGTWQLKQVPVLQAALGNDAG
IIGAAYLAMKTSSQY
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
ttgtgccttttgggtatcgatctcggcggtacatcaattaaggccgggctggtggatata
aacggaaagattctgaaaaaaggacaggtgcctacgggggccggtgaaggtacaaccgca
gttttaaagcgcatcaagaacctggcccgggacctggccggtgaacagggtctggctctg
ggtgaactcgaagggatcggtatcggtattcccggatcggttgatgtggccagggggttg
gtccacctggctcccaatctcttctggcgcgatttctccctccgggatgaactggcagcc
ttactggatctacctgtggctattgaaaatgacgcccacgttgccgccctgggggagatg
tggcagggagccggccggggatatacctccctcctcatggtaaccattggcacgggtatc
ggctcaggactgattattgacggtcgcgtccatcacggccttttcggttatggagcggag
atggggcatataaaaatggtctgtgacggccggcagtgtcactgtggcggccatggctgc
ctggagaccctggcttcggccacagctatggtaaagtctttccgggagtacctggcagcg
ggttacccatccatgttatcggataggcccgaacttggggcgaaggagatcctggcagcc
gccgccgggggcgacgaactggctggccgcgtcatcgacgaggccgcctgctatttggga
acagccctggccaatgccgtcctcctggtggggccggaagcaataattatcgggggggga
ccggcccaggccggggaggtaatcttagatcctatccgcaaacacctggctgcagccatg
ggaacctggcagcttaagcaagtaccggtcctacaggctgccctgggtaatgatgcaggt
attatcggcgccgcttatctggctatgaagacgagctcacaatattga

DBGET integrated database retrieval system