KEGG   Moorella thermoacetica: Moth_0843Help
Entry
Moth_0843         CDS       T00308                                 

Gene name
murG
Definition
(RefSeq) undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
  KO
K02563  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC:2.4.1.227]
Organism
mta  Moorella thermoacetica
Pathway
mta00550  Peptidoglycan biosynthesis
mta01100  Metabolic pathways
mta01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mta00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Moth_0843 (murG)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Moth_0843 (murG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mta01011]
    Moth_0843 (murG)
Enzymes [BR:mta01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.227  undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
     Moth_0843 (murG)
Peptidoglycan biosynthesis and degradation proteins [BR:mta01011]
 Precursor biosynthesis
  Glycosyltransferase
   Moth_0843 (murG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_28 Glyco_tran_28_C Glyco_trans_1_3 Glyco_trans_4_4 Glyco_transf_4 DUF4830 Mito_fiss_Elm1
Motif
Other DBs
NCBI-GeneID: 3831540
NCBI-ProteinID: YP_429703
UniProt: Q2RK79
Position
875996..877111
Genome map
AA seq 371 aa AA seqDB search
MRVIITGGGTGGHVYPALAIARGLKEARPGVELLYIGTARGLEADVVPRAGLTLATITVQ
GLVRRQVWKNIPALVKTGRGLGEAWQQVRRFRPDVVVGTGGYVSGPVCLAAALQGVPVIL
HEQNAFPGVTNRLLAILARCVCLTFPEAASRFPRRAKLVTTGLPVRPEIIQADRDSCRQH
FGLRPEQLFLVTVGGSQGARSINGAMLPILKELAGCQDVSLLQVTGRRDYEAYLQQVRTQ
GIDLAKYGNITIEPYVYNLEQALAAADLVIGRAGASFLAEVLARGLPSVLVPYPHAAANH
QEYNARAVARQGAAVVVLDRELKGGRLYQVVFELLRSREKLKAMAAAAASLGRPGALEAI
IQVILKTVESG
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
ttgcgggtgataattaccggcggcggtaccgggggccatgtttacccggccctggccatt
gctcgcggccttaaagaggccaggccgggggtagagttactgtatatcgggacggccagg
ggtctggaagctgacgtggtaccccgggctggcctgaccctggccaccattaccgtccag
gggctggtgcgacggcaagtatggaagaacattcccgccctggtgaagaccggccggggg
cttggcgaggcctggcagcaggtgcgccgttttcgaccagacgtagtagtcggcaccggt
ggctatgtcagcggcccggtgtgcctggctgccgccctccagggcgtaccggtaatcctc
catgaacagaatgcctttccgggtgttaccaatcggctgctggcgatcctggctcgctgc
gtctgcctgacctttcccgaggcagcctcccgtttccctcgccgggcaaaactggttacc
accgggctaccggtacggccggagataatccaggcggaccgggattcatgccggcagcat
ttcggcctgcggccggagcaactcttcctggtaactgttggtggcagccagggggccagg
agtattaacggggccatgttacctattttgaaggaactggccgggtgccaggatgtcagc
cttctccaggtaacaggacgccgggactatgaggcttatttacagcaggtgcgcacccag
ggaatagatctggctaaatatggcaacattaccattgaaccctatgtctataacctggag
caggccctggctgcagccgacctggtcatcggccgggccggggcctcctttttagccgaa
gtactggcccggggtctgccgtccgtcctggttccctatccccatgcggcagccaatcat
caggagtataatgcccgggccgtggcccggcagggggcggccgtggtggtcctggaccgg
gaactaaaaggagggcggctttaccaggttgtattcgaactcctgagatcaagggaaaag
ctaaaggccatggcggctgccgccgcttcattaggtcgtcccggagccctggaggctatt
atccaggttatcttgaaaacggtcgaatcaggttag

DBGET integrated database retrieval system