KEGG   Moorella thermoacetica: Moth_1041Help
Entry
Moth_1041         CDS       T00308                                 

Definition
(RefSeq) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mta  Moorella thermoacetica
Pathway
mta00900  Terpenoid backbone biosynthesis
mta01100  Metabolic pathways
mta01110  Biosynthesis of secondary metabolites
mta01130  Biosynthesis of antibiotics
Module
mta_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mta00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Moth_1041
Enzymes [BR:mta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Moth_1041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom Sacchrp_dh_NADP NAD_binding_3 NmrA Semialdhyde_dh
Motif
Other DBs
NCBI-GeneID: 3831847
NCBI-ProteinID: YP_429898
UniProt: Q2RJN4
Position
1068326..1069483
Genome map
AA seq 385 aa AA seqDB search
MAKEITVLGSTGSIGRQTLEVVAAHPGRFRVAALVAARNDELLAAQVRRFRPRLAVLLDE
ERARVLAEMVSDPGIRILAGEEGLMAAACLEGVELVVAAMVGIRSLKAILAALEAGKDIA
LANKEVLVAAGQLVMDRARRLSRQIIPVDSEHSAIFQCLRQGGRVAEVIITASGGPLRQM
PRAEMANVTPEQALNHPTWVMGPKITIDSATLMNKGLEVIEAKHLFNLDFDQIKVLIHPQ
SVVHALVRYSDGALFAQLGPADMRLPIQYALTWPERWDLDVQPLDLAALGHLEFALPDLE
RFPCLELALQAGRAGGTYPAVLSAADEVAVEYFLAGKITLTAISQVVGRVLDEHQPEPVP
DLEGILAADAWARRRAGAVAEGLSF
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
ttggctaaagagataactgtactgggatcaacgggttccattggccggcagaccctggag
gttgttgctgcccaccccggcaggttcagggtcgccgccctggtagcagccaggaatgac
gagcttctggccgcccaggtgcgcaggttccggccccgcctggcggttcttttggatgaa
gagcgggcccgggtcctggccgaaatggtcagcgaccccggaatccgcatcctcgccggg
gaagagggcctgatggccgccgcctgcctggaaggagtggaactggtggtggcggccatg
gtcggcattcgcagcctgaaagccattctggcggccctggaggcgggaaaagatatcgcc
ctggccaacaaagaggtcctggtggcggccggtcaactggtcatggaccgggcccggcgc
ctcagccgccagattatacccgtggatagcgagcactcggccatcttccagtgcttgcgc
cagggaggccgggtggcagaggtaataatcactgcctccggaggacccctgcggcagatg
ccccgggccgagatggctaacgttactccagagcaggctttaaaccatcccacctgggtg
atggggccgaagataaccatagattccgcgaccctgatgaacaaggggctggaggtaatt
gaagccaaacatctctttaacctcgattttgatcaaatcaaggtcttgattcatccccag
agcgttgtacacgccctagtgcgttacagcgacggggctctttttgcccaactggggccg
gccgatatgcgcctgcccatccagtatgccctgacctggccggagcgttgggatctggac
gtgcagcctctggatctggcagcactgggacacctggaatttgctctgccggacctggag
cgtttcccctgcctggagctggcgctccaggcaggtcgtgccgggggcacttacccggcg
gtcctgagcgctgccgatgaagtggcggtggaatatttcctggccgggaagataaccctt
accgccatcagccaggtggtaggacgggtcctggatgagcatcaaccggagcctgtaccc
gaccttgaaggcatcctcgccgccgatgcctgggcccgacggcgggcaggagcagtagct
gaaggattgtcgttttaa

DBGET integrated database retrieval system