KEGG   Moorella thermoacetica: Moth_1098Help
Entry
Moth_1098         CDS       T00308                                 

Definition
(RefSeq) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
mta  Moorella thermoacetica
Pathway
mta00860  Porphyrin and chlorophyll metabolism
mta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mta00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Moth_1098
Enzymes [BR:mta01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     Moth_1098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA GATase DJ-1_PfpI SNO Peptidase_S51 MobB
Motif
Other DBs
NCBI-GeneID: 3833064
NCBI-ProteinID: YP_429955
UniProt: Q2RJH7
Position
1124932..1126485
Genome map
AA seq 517 aa AA seqDB search
MAKAIMLQGTSSNVGKSVLAAALCRIFHRNGYRVSPFKSQNMALNSGATPDGGEMGRAQI
VQAMAAGVVPRVEMNPILLKPTAHASSQVIVLGRPVGNLGAREYHGHFNQKLWSRVEEAY
AFLEREFEIIVIEGAGSPAEINLKAGEIANMRVARMAGAPVLLVADIDRGGALAAVVGTL
ELLEPEERVMVAGIIINKFRGDLDLLKPALDFLESRTGKPVLGVIPFLPDHGLPEEDSVV
LEGVTGRSTGAGEVEIAVIKLPCISNFTDFDALEREKGVNLRYVEAASDLGNPDLVILPG
SKNTIGDLLWLRCQGLETAIKELAGRGTPIIGICGGYQMLGKEIRDPEHVETDVEMIKGL
DLLPIKTVFQTSKATNQVRGVVTGSGPFLGPLQGQEVQGYEIHMGASFLLDGRPAFKITS
RGGRLVTLDDGALAGEGRIWGTYIHGILDNDSLRHQVISVLRARRGLPARPGMLNFMAEQ
ERRLDILAGEVARHLDLGRLAAIMGLERPLVWTGHDN
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
gtggccaaagctattatgctccagggaaccagttccaatgtcggcaagagtgtcctggca
gcggccctctgccggattttccaccggaacggctatcgggtgagcccctttaaatctcag
aatatggcgcttaactccggagccacccccgatggaggcgagatgggccgggcccagatc
gtccaggccatggcggccggggtggtaccccgcgtagagatgaacccgatcctacttaaa
ccgacggcccatgccagctcccaggtaatcgtcctcgggcgaccggtgggcaacctgggc
gcccgggagtaccacggccatttcaaccagaagctctggtcccgggtagaagaggcttat
gccttcctggagcgggagtttgagattattgtaatcgagggggccggcagtccggcggaa
atcaacctcaaggccggggagatcgccaatatgcgggtggccaggatggccggagccccg
gtgctcctggtagctgatattgacagaggtggcgccctggcagctgtagtgggcaccctg
gagctcctggaaccggaagagagggtaatggtggccggcatcatcattaacaagttccgg
ggtgatctcgaccttctaaaaccggctctggactttctggaaagccgcaccggtaaaccg
gtactcggcgtgatcccctttttacccgaccacgggctgccggaggaggattccgttgtc
ctggaaggggtcaccggtcgctcgacgggtgccggtgaagtggagatagcggttatcaag
ctgccctgcatctccaattttaccgactttgacgccctggaaagggagaagggggtcaat
ctccgttatgtagaagcagcgagcgacctgggcaatccagatctggtcatcctgcccggc
agcaaaaacaccatcggcgatttattatggctgcggtgccaggggctggagacagccatt
aaagagctggccggccggggaacgccgattatcgggatttgcggtggttatcagatgctg
ggaaaggagatcagggaccccgagcatgtggaaaccgatgtggagatgataaaaggcttg
gaccttttaccaatcaaaaccgtctttcaaacctccaaggccaccaaccaggtccggggc
gtggttacgggttcaggacccttcctggggccattgcagggccaggaggttcaaggatat
gagatccatatgggtgccagctttttgctggacggcaggccggcctttaagatcacctca
cggggcggccgactggtgaccctcgacgatggggccctggccggggagggacgcatctgg
ggtacctacatccacggcattctggataacgattctctgcgccaccaggttatctcagtc
ttaagggccaggcgcggcctaccggccaggccggggatgctgaactttatggccgagcag
gaaagacgccttgatattctggccggtgaggtggcccggcacctggatctgggccgcctg
gcggcaatcatggggttggaacgccccctggtatggaccggccatgacaactga

DBGET integrated database retrieval system