KEGG   Moorella thermoacetica: Moth_1260Help
Entry
Moth_1260         CDS       T00308                                 

Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mta  Moorella thermoacetica
Pathway
mta00071  Fatty acid degradation
mta00280  Valine, leucine and isoleucine degradation
mta00362  Benzoate degradation
mta00380  Tryptophan metabolism
mta00620  Pyruvate metabolism
mta00630  Glyoxylate and dicarboxylate metabolism
mta00640  Propanoate metabolism
mta00650  Butanoate metabolism
mta00720  Carbon fixation pathways in prokaryotes
mta00900  Terpenoid backbone biosynthesis
mta01100  Metabolic pathways
mta01110  Biosynthesis of secondary metabolites
mta01120  Microbial metabolism in diverse environments
mta01130  Biosynthesis of antibiotics
mta01200  Carbon metabolism
mta01212  Fatty acid metabolism
mta02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Moth_1260
   00630 Glyoxylate and dicarboxylate metabolism
    Moth_1260
   00640 Propanoate metabolism
    Moth_1260
   00650 Butanoate metabolism
    Moth_1260
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Moth_1260
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Moth_1260
   00072 Synthesis and degradation of ketone bodies
    Moth_1260
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Moth_1260
   00310 Lysine degradation
    Moth_1260
   00380 Tryptophan metabolism
    Moth_1260
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Moth_1260
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Moth_1260
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Moth_1260
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mta04147]
    Moth_1260
Enzymes [BR:mta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Moth_1260
Exosome [BR:mta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Moth_1260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-GeneID: 3833055
NCBI-ProteinID: YP_430117
UniProt: Q2RJ15
Position
complement(1303632..1304813)
Genome map
AA seq 393 aa AA seqDB search
MKDVVIVSGVRTAVGTRGGSLKDIHQADLGAMVIKEAVRRAGLEGNQVDEVIVGNVGQVA
ENGFIARMCSLKAGLPLETTAFSVNRQCGSGLQAINSAVQEIQSGNAEIVVACGTENMNQ
LPYYVRKARYGYGFGHGQLEDGLLTILTWPLGPYPNGVTAENIAERYHISREEQDAFALK
SQQKAEAAIKAGKFVDEILPVEVPAGKRETRIFAQDEHPRFGLTMEQLAKLKPAFREGGT
VTAGNSSGINDGAGAVVLMTAEKANKLGLKPLLLIRSQAVAGVDPDVMGIGPAPATMKAV
EKAGLTLADIDLFELNEAFASQSIAVMRILGLPEEKVNVNGGAIALGHPIGATGIILTVK
LQKEMVRRQAKYGIVTMCIGGGQGIATVFENIA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatgttgttatagttagcggtgtcaggacagcggtagggacccgtggtggtagc
ctgaaggatatccaccaggctgacttgggtgccatggtgattaaagaggccgtccggagg
gcaggtttggaaggcaaccaggttgatgaggttattgtcggcaatgtcggccaagttgca
gaaaacggttttatcgccaggatgtgttctttaaaggcagggttacctctggagacaaca
gctttttcagtaaaccgccagtgtggttcgggactgcaggccatcaacagcgccgttcag
gagattcaaagtggcaatgctgaaattgtcgtcgcctgcggcaccgagaatatgaaccag
ttaccctattatgttcggaaagcccgttatggttatgggtttggccatggccaattagaa
gacggtttgcttaccattttaacctggcccctgggaccgtatccaaatggtgtcacagcc
gaaaacattgctgaacgttaccatatctccagggaagaacaagatgcctttgctttaaag
agccagcagaaagctgaggctgccattaaagctggcaaatttgtggacgaaattctcccg
gttgaagtccctgccggtaaaagggaaaccaggatttttgcccaggatgaacatcctcgt
tttggcctcaccatggagcaactggcaaaattaaagcctgctttccgggaaggcggtacg
gtaactgctggcaattcttcgggtatcaacgacggcgctggagcagtagttctaatgacg
gccgaaaaagccaacaaacttggcctcaagcccttactgctaatccgcagccaggcagtg
gccggggttgatccagatgttatgggcatcggtcctgcccccgcgactatgaaggcagtc
gagaaagccgggctaacccttgctgatatcgacctctttgagctgaatgaagcttttgcc
tcccagtcgattgccgttatgcgcattctgggacttcccgaagaaaaggtaaacgttaat
ggtggcgccatcgccctgggtcaccccatcggtgcaaccggcattatcttaactgttaaa
ttacaaaaagaaatggtacgtcgccaggctaaatatggtatcgttaccatgtgtattggc
ggcggccagggtattgctacggtctttgaaaatatagcttaa

DBGET integrated database retrieval system