KEGG   Moorella thermoacetica: Moth_1336Help
Entry
Moth_1336         CDS       T00308                                 

Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mta  Moorella thermoacetica
Pathway
mta00260  Glycine, serine and threonine metabolism
mta00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mta01100  Metabolic pathways
mta01110  Biosynthesis of secondary metabolites
mta01130  Biosynthesis of antibiotics
mta01230  Biosynthesis of amino acids
Module
mta_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mta00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Moth_1336
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Moth_1336
Enzymes [BR:mta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Moth_1336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA
Motif
Other DBs
NCBI-GeneID: 3831046
NCBI-ProteinID: YP_430192
UniProt: Q2RIU0
Position
complement(1382545..1383327)
Genome map
AA seq 260 aa AA seqDB search
MGVERITAAFAARKKEGRKALIVYLCAGDPSLEVTGQAVRELAGAGVDLIELGVPFSDPV
ADGPVIQAASKRALAAGVTLPEILELVKSLRSGLAVPLILMSYYNPLLQYGLERLTADLA
AAGVDGLIVPDLPLEENPPLRQTLEPAGLALIPLVAPTTPGERLARIAATARGFIYCVSL
TGVTGVREGLPPGIDEYLAGVRAVTDLPLGIGFGIGSPDQARLLAPMGDGIIVGSALVDV
LYQEGLPAALRLVERLRHAL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgggtgttgaaagaataactgctgcctttgccgcccggaaaaaagagggacgcaaagcc
ctcatcgtctatctctgtgccggcgacccttccctggaggttaccgggcaagctgtcagg
gaactggctggcgccggggtggacctcattgagctgggggtacccttttctgaccccgtg
gccgatggtccggtcatccaggctgccagcaagcgtgcccttgccgccggggtaaccctg
cccgaaatcctggaattggtaaagagcctgcgctcggggttggctgtccccttgatcctc
atgagctactataaccctttgctgcaatatggactggaacggttaactgccgatctggcc
gctgccggggtggatggtttgattgtacccgatctgcccctggaagaaaacccaccttta
agacaaaccctggaaccggcggggctggccctgattcccctggtggccccgacgaccccc
ggggaacgtttggcccggattgccgccacagcccggggatttatctactgcgtttccctt
accggggtaacaggcgtccgggaaggcttgccgccgggaatagacgagtacctggcaggg
gtgcgggcggtaactgacctgcccctgggaataggtttcggcatcggcagtcccgaccag
gccaggctcctggcccctatgggcgacggcattattgtcggcagcgccctggtcgacgtc
ctgtatcaagaaggcttaccggccgccctccggctggtagaaaggctccggcacgcttta
tag

DBGET integrated database retrieval system