KEGG   Moorella thermoacetica: Moth_1525Help
Entry
Moth_1525         CDS       T00308                                 

Definition
(RefSeq) pyruvate carboxylase subunit B
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
mta  Moorella thermoacetica
Pathway
mta00620  Pyruvate metabolism
mta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Moth_1525
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mta02000]
    Moth_1525
Enzymes [BR:mta01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Moth_1525
Transporters [BR:mta02000]
 Other transporters
  Primary active transporters [TC:3]
   Moth_1525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 GCV_H HlyD_3 RnfC_N RMI1_N
Motif
Other DBs
NCBI-GeneID: 3831990
NCBI-ProteinID: YP_430377
UniProt: Q2RIA5
Position
complement(1570431..1572362)
Genome map
AA seq 643 aa AA seqDB search
MAVAEPAMGNVALALARVFLYGGGAVLSQLKITDTTLRDGHQSLWATRMTTADMLPIIEK
IDSVGYHSLEVWGGATFDVCMRFLDEDPWERLRTLKKYARRTPLQMLLRAQSLVGYQLYP
DDVVRAFIARAAANGIDIIRIFDALNDLRNMEVPVEAAKKEGVHVQGTVVYTISPVHTTE
HYLKTALELESMGVDSICIKDMAGLLAPFEAYKLVKLFKEKLHVPVQLHSHYIGGLAVGA
YLEAARAGVDVVDTASVPLAFGASQPPVETVVRALEGTPYDTGLDLNLLFEIARYFDDLR
RELGYERGVTRITDMWVFQHQVPGGMISNLVSQLKEQKAADRINEVLAEIPRVRADLGYP
PLVTPTSQIVGTQAVLNVLLGERYKMVPGEVKNYVRGLYGRPPAPISEEIRRLIIGDEEP
IQGRPADILEPRLEEARREIGDLARNEDDVVAYAMFPQIARKFFEKRQQGQLRPGRQSLP
SRGQDKAEAGGTAKMDLKDITQLIKALEETGITELNLESEGVKVMIRRGSGQGAAEIPAP
EIKTAAEVLATDGGAQETPVPAGDIIEVRAPMVGTFYRAPSPDAPPFVEVGTRVKAGQTL
CIIEAMKLMNELTAETGGQVVAILAENGQPVEYGQVLFQIKKD
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggcggttgcagagccagccatggggaatgtcgccctggctttagccagggtttttctt
tacgggggaggagcagttttgagccagttgaagattacagacaccaccttgcgcgatggc
caccagagcctttgggccaccaggatgactacggccgatatgctgcccattatcgaaaag
atcgatagtgtcgggtaccactccctggaggtctggggtggggccaccttcgatgtctgc
atgcgcttcctggatgaggatccctgggagcgcctccgtaccttgaaaaaatatgcccgg
cggacgcccctgcagatgcttctccgggcccagtccctggtgggctaccagctgtacccg
gacgatgtagtacgggcctttatcgccagggccgcggccaacggcattgatattatccgc
attttcgacgccctgaacgacctgcgcaacatggaagtcccggtggaagccgccaaaaag
gaaggtgtccacgtccagggaacggtggtctataccatcagcccggtgcataccaccgag
cactacctgaaaacagccctggaactggagagtatgggggtcgattccatttgcattaaa
gatatggccggcctcctggctccctttgaagcctataaactggtcaagctctttaaagaa
aaactccacgtccccgttcagctccatagccattacatcggcggtctggcggttggggcc
tacctggaagcggcccgggccggggtggatgtcgtcgacacagcctctgttcccctggcc
ttcggcgcctcccagccgccggtggagacggtggtccgggccctggagggaacgccctat
gacaccggcctggatctcaacctcctctttgaaatcgcccgctatttcgacgacctgcgc
cgggaactgggttacgagcgcggcgtcacccggattaccgatatgtgggttttccagcac
caggtccccgggggcatgatctccaacctggtcagccagttaaaggaacaaaaggccgcc
gaccggatcaacgaggtcctggccgagataccccgggtacgggccgacctgggttacccg
cccctggtcacgcccaccagccagattgtcggtacccaggcggttttaaacgtcctcctg
ggcgaacgttacaagatggtacccggcgaggtgaagaattacgtccggggcctgtacggc
cggccgccggcacccatttccgaggagatccggcgcctgataatcggcgatgaagagccc
atccaggggcgaccggccgacatcctggagccccgcctggaggaagcgcggcgggagatc
ggcgatctggcccgtaatgaggacgacgtggttgcctacgccatgtttccccagattgcc
cggaaattctttgagaagcgccagcagggccagctccggccgggccggcagtctttacca
tccaggggccaggataaggcagaggcaggaggtacagcaaagatggatctcaaggatatc
acccagctcattaaagccctggaagagacggggattaccgaactgaacctggagagcgaa
ggggtaaaggtcatgatccgccgcggtagcggccagggggcggcggagatccccgcaccg
gagataaaaactgctgcagaggtactggccacagacggcggcgctcaggaaacacctgtc
ccggccggagatatcattgaagtccgggcgcccatggtgggtaccttttaccgggctccc
tctcccgacgcgcccccttttgtcgaggtggggaccagggttaaggcaggacaaaccctg
tgcataatagaggcgatgaagctaatgaacgagctcacggctgaaaccggcggccaggtg
gtggccatcctggccgaaaacggccagccggtggaatacggccaggtcttgttccagatc
aagaaggattaa

DBGET integrated database retrieval system