KEGG   Moorella thermoacetica: Moth_1911Help
Entry
Moth_1911         CDS       T00308                                 

Definition
(RefSeq) Iron-containing alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
mta  Moorella thermoacetica
Pathway
mta00010  Glycolysis / Gluconeogenesis
mta00071  Fatty acid degradation
mta00350  Tyrosine metabolism
mta00625  Chloroalkane and chloroalkene degradation
mta00626  Naphthalene degradation
mta01100  Metabolic pathways
mta01110  Biosynthesis of secondary metabolites
mta01120  Microbial metabolism in diverse environments
mta01130  Biosynthesis of antibiotics
mta01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Moth_1911
  Lipid metabolism
   00071 Fatty acid degradation
    Moth_1911
  Amino acid metabolism
   00350 Tyrosine metabolism
    Moth_1911
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Moth_1911
   00626 Naphthalene degradation
    Moth_1911
Enzymes [BR:mta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Moth_1911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 Cas_APE2256 Smr
Motif
Other DBs
NCBI-GeneID: 3830835
NCBI-ProteinID: YP_430754
UniProt: Q2RH78
Position
1979946..1981145
Genome map
AA seq 399 aa AA seqDB search
MWETKININEVREIRAKTTVYFGVGAIKKIDDIAREFKEKGYDRIIVITGKGAYKATGAW
EYIVPALNKNQITYIHYDQVTPNPTVDQVDEATKQAREFGARAVLAIGGGSPIDAAKSVA
VLLSYPDKNARQLYQLEFTPVKAAPIIAINLTHGTGTEADRFAVVSIPEKAYKPAIAYDC
IYPLYSIDDPALMVKLPSDQTAYVSVDALNHVVEAATSKVASPYTIILAKETVRLIARYL
PQALSHPADLTARYYLLYASLIAGIAFDNGLLHFTHALEHPLSAVKPELAHGLGLGMLLP
AVVKQIYPATPEVLAEILEPIVPDLKGVPGEAEKAASGVAKWLAGAGITMKLKDAGFQAE
DIARLTDLAFTTPSLELLLSMAPVTADRERVKAIYQDAF
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtgggaaacaaaaataaacatcaacgaagtccgggaaatccgggctaaaacaaccgtc
tactttggagttggagctattaaaaagattgacgacatagccagggaatttaaggaaaag
ggatacgataggatcatcgtaataaccggcaagggggcttataaagccaccggcgcgtgg
gaatatatagttccggccttaaataaaaaccagataacctatatccattacgaccaggtg
acgcccaacccgacggtagaccaggttgacgaggcaaccaaacaagcccgggaattcggt
gcccgagccgtcctggccatcggcgggggtagccccattgatgccgctaaaagcgtagcc
gtcttgctctcctaccccgacaaaaatgcccgacagctctaccagttagaatttacacct
gttaaggccgcacctatcatcgctattaatcttacccatggtacggggacggaagccgat
cgctttgccgttgtcagcatccctgaaaaggcatataaacccgctattgcctatgattgc
atttaccccttatattcaattgacgacccggccctcatggtaaaactgccgtccgaccag
acagcttatgtctctgttgatgccctcaaccatgtcgtcgaagcagccaccagcaaagta
gccagcccctatactattatcctggccaaggaaacggtacggctcatcgcccgatacctg
ccccaggccctgtcccatccggcggatttgacggccaggtattatctcctctatgcttcc
ctgattgccggaatagcctttgacaacggtttgctccacttcacccacgccctggaacac
cccctgagcgccgtcaaaccggagctcgcccacggtctggggctgggtatgctgctgccg
gccgtagtcaagcagatttacccggcaaccccggaggtactggcggagatactggagccc
attgttcccgatctcaaaggcgttcccggtgaagcagaaaaggctgccagcggggtggca
aaatggcttgccggagccggtattaccatgaagctaaaagatgcgggctttcaagcggaa
gatatcgccaggttaactgacctggcctttaccaccccgagtctcgagcttctcctgagt
atggccccggtaacggccgacagggaaagggttaaggcaatttaccaggacgccttttaa

DBGET integrated database retrieval system