KEGG   Moorella thermoacetica: Moth_1921Help
Entry
Moth_1921         CDS       T00308                                 

Definition
(RefSeq) pyruvate ferredoxin oxidoreductase subunit beta
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
mta  Moorella thermoacetica
Pathway
mta00010  Glycolysis / Gluconeogenesis
mta00020  Citrate cycle (TCA cycle)
mta00620  Pyruvate metabolism
mta00633  Nitrotoluene degradation
mta00640  Propanoate metabolism
mta00650  Butanoate metabolism
mta00680  Methane metabolism
mta00720  Carbon fixation pathways in prokaryotes
mta01100  Metabolic pathways
mta01120  Microbial metabolism in diverse environments
mta01130  Biosynthesis of antibiotics
mta01200  Carbon metabolism
Module
mta_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Moth_1921
   00020 Citrate cycle (TCA cycle)
    Moth_1921
   00620 Pyruvate metabolism
    Moth_1921
   00640 Propanoate metabolism
    Moth_1921
   00650 Butanoate metabolism
    Moth_1921
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Moth_1921
   00680 Methane metabolism
    Moth_1921
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Moth_1921
Enzymes [BR:mta01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Moth_1921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-GeneID: 3830845
NCBI-ProteinID: YP_430764
UniProt: Q2RH68
Position
complement(1993441..1994262)
Genome map
AA seq 273 aa AA seqDB search
MVKIKELPDNELVQGSYACAGCGGILAVRMALKVLGPETVIVTTPSCLLGVTTFYPQLAF
KVPCVNVTFPSTAAAISGVVAGLRRRGKSGVKVVGLAGDGGTVDIGLQALSGAIERGDNF
IFICYDNEAYMNTGVQRSGATPLGARTTTTPVGRAGRGEDRPKKDMLAIVAAHNVPYAAT
ASIGYPQDYLTKVQKAMEIEGPAYIQVLAPCPPGWGYSSHLTVKLARLAVQTGQWPLAEY
ERGRLTVKEVANPRPLKEYLAPQARFAHLLASK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggttaagataaaagaactccccgacaatgagctggtccagggttcctatgcctgtgcc
ggctgcggcgggatcctggccgtgcgtatggccctgaaggtcctggggccggaaacggtg
attgtcaccacaccgagctgtctcctgggggtgaccaccttttacccccagctggccttt
aaagtgccctgcgtcaatgtcaccttccccagcacggcggcggccatttccggagtggtg
gcgggtttgaggcgccggggcaagagcggggtgaaagtcgtgggcctggccggcgacggc
ggcactgtggacatcggcctccaggccctctccggggccatagagcggggcgacaacttt
atctttatctgttacgataacgaggcctacatgaacaccggcgtgcagcggagcggcgcc
acccccctgggggcgcggacgacgaccacaccggtgggcagggccggccggggtgaagac
aggcccaagaaggacatgctggccatcgtcgccgcccataacgtcccctacgcggccacg
gccagtatcggctacccccaggattacctgaccaaggtgcagaaggccatggagatagag
ggaccggcttacattcaggtcctggccccctgcccgccggggtggggttacagcagccac
ctgaccgtaaaactcgcccgcctggccgtccagacgggccagtggcccctggccgaatat
gaaagggggcggctgaccgttaaagaggttgccaatccccgtcccttaaaagagtacctg
gccccccaggcccgtttcgcccacctgttggcttccaaataa

DBGET integrated database retrieval system