KEGG   Meiothermus taiwanensis: Mtai_v1c27160Help
Entry
Mtai_v1c27160     CDS       T05633                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
mtai  Meiothermus taiwanensis
Pathway
mtai00260  Glycine, serine and threonine metabolism
mtai01100  Metabolic pathways
mtai01110  Biosynthesis of secondary metabolites
mtai01120  Microbial metabolism in diverse environments
mtai01130  Biosynthesis of antibiotics
mtai01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtai00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mtai_v1c27160
Enzymes [BR:mtai01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Mtai_v1c27160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Cys_Met_Meta_PP Aminotran_3 PreAtp-grasp
Motif
Other DBs
NCBI-ProteinID: AWR87944
Position
2792545..2793564
Genome map
AA seq 339 aa AA seqDB search
MRIIDLRSDTVTRPTPAMRKAMAEAEVGDDVYGEDPTVNRLEALAAEMLGFETALFMPSG
TMTNQVALMLHLKRGQEVIAPEGAHIYEYEPGSLAVLAGGTIRLVKAPYGIPDPEAVRAA
IHTSVHQAPTGLIALENTHNTAGGTVVPIAVQRAIQRVAEEAGLPTHLDGARFFNAVVAL
QTTPVELAKGFRTVSICLSKGLGAPVGSLLLMPKEYRAEAWRYRKLLGGGMRQAGVLAAA
GILALTEGPGHLARDHQMARALAEGLLRLCLEVDLQAVQTNMVYVQIPQAPAFVQRLRGL
GVLANAMGPSRVRFVTHRDLHDEDIPLALKRIEQALQVA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcatcgacctccgctccgacaccgtgacccggcccaccccggccatgcgcaag
gccatggccgaggccgaggtgggcgacgatgtctacggcgaagaccccaccgtgaaccgg
ctcgaggccctcgcggccgagatgctgggtttcgagaccgccctttttatgcccagcggc
accatgaccaaccaggtcgccctgatgctgcacctcaagcgcgggcaggaggtgatcgcc
cccgaaggggcccacatctacgagtacgagccgggctcgctggcggtgctcgcgggcgga
accatccggctggtgaaggcgccctacggcatacccgaccccgaggcggtgcgggccgcc
atccacacctcggtgcaccaggcccccaccggcctgatcgccctggagaacacccacaac
accgcgggcggcacggtggtgcccatcgccgtgcagcgggccatccagcgggtggcggag
gaggccgggctgcccacccacctggacggggcgcgttttttcaacgcggtggtggccctg
caaaccacccccgtcgagctggccaaaggcttccgcaccgtctctatctgcctatccaag
gggctgggggccccggtgggctcccttttgctgatgcccaaggaataccgcgccgaggcc
tggcgctaccgcaagctgctgggcggggggatgcggcaggcgggggtgctggccgcggcg
ggcatcctggccctgaccgaaggccccgggcacctggcccgcgaccaccagatggcccgg
gccctggccgaggggttgttgcggctttgcctcgaggtggatctgcaggcggtgcagacc
aacatggtgtacgtgcagataccccaggccccggccttcgtccagcgcctgcgcgggctg
ggcgtgctggccaacgccatggggcccagccgggtgcgcttcgtcacgcaccgcgacctg
cacgacgaggacatccctctggccctgaagcgaatcgagcaggccttgcaggtggcctag

DBGET integrated database retrieval system