KEGG   Mycobacterium tuberculosis KZN 1435: TBMG_00224Help
Entry
TBMG_00224        CDS       T00940                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mtb  Mycobacterium tuberculosis KZN 1435
Pathway
mtb00010  Glycolysis / Gluconeogenesis
mtb00053  Ascorbate and aldarate metabolism
mtb00071  Fatty acid degradation
mtb00280  Valine, leucine and isoleucine degradation
mtb00310  Lysine degradation
mtb00330  Arginine and proline metabolism
mtb00340  Histidine metabolism
mtb00380  Tryptophan metabolism
mtb00410  beta-Alanine metabolism
mtb00561  Glycerolipid metabolism
mtb00620  Pyruvate metabolism
mtb00625  Chloroalkane and chloroalkene degradation
mtb00903  Limonene and pinene degradation
mtb01100  Metabolic pathways
mtb01110  Biosynthesis of secondary metabolites
mtb01120  Microbial metabolism in diverse environments
mtb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mtb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TBMG_00224
   00053 Ascorbate and aldarate metabolism
    TBMG_00224
   00620 Pyruvate metabolism
    TBMG_00224
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TBMG_00224
   00561 Glycerolipid metabolism
    TBMG_00224
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TBMG_00224
   00310 Lysine degradation
    TBMG_00224
   00330 Arginine and proline metabolism
    TBMG_00224
   00340 Histidine metabolism
    TBMG_00224
   00380 Tryptophan metabolism
    TBMG_00224
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TBMG_00224
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    TBMG_00224
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    TBMG_00224
Enzymes [BR:mtb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     TBMG_00224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ACT23251
Structure
PDB: 

Position
complement(266242..267705)
Genome map
AA seq 487 aa AA seqDB search
MSDSATEYDKLFIGGKWTKPSTSDVIEVRCPATGEYVGKVPMAAAADVDAAVAAARAAFD
NGPWPSTPPHERAAVIAAAVKMLAERKDLFTKLLAAETGQPPTIIETMHWMGSMGAMNYF
AGAADKVTWTETRTGSYGQSIVSREPVGVVGAIVAWNVPLFLAVNKIAPALLAGCTIVLK
PAAETPLTANALAEVFAEVGLPEGVLSVVPGGIETGQALTSNPDIDMFTFTGSSAVGREV
GRRAAEMLKPCTLELGGKSAAIILEDVDLAAAIPMMVFSGVMNAGQGCVNQTRILAPRSR
YDEIVAAVTNFVTALPVGPPSDPAAQIGPLISEKQRTRVEGYIAKGIEEGARLVCGGGRP
EGLDNGFFIQPTVFADVDNKMTIAQEEIFGPVLAIIPYDTEEDAIAIANDSVYGLAGSVW
TTDVPKGIKISQQIRTGTYGINWYAFDPGSPFGGYKNSGIGRENGPEGVEHFTQQKSVLL
PMGYTVA
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacagtgccacggaatacgacaagcttttcatcggcggcaagtggaccaaaccg
tcgacctccgatgttatcgaggtacgctgcccagccactggggaatatgtcggcaaggtg
ccgatggcggccgccgccgacgtcgacgccgcggtcgccgcagcacgtgcggcgttcgac
aacggcccctggccctcgaccccgccgcacgagcgtgcggcggtgatcgctgcggcggtc
aagatgctggctgagcgcaaggacctgttcaccaagctgctcgcagccgaaaccggccag
ccgccgaccatcatcgagacgatgcactggatgggttcgatgggggcgatgaactacttt
gccggtgcagcggacaaggtcacctggaccgaaacccgcaccggctcctatggacagagc
attgtcagccgtgagccggtcggtgtggtgggcgcgatcgtggcctggaacgtcccgctg
tttctggccgtcaacaagattgcgccggcgctgctggccggctgcaccatcgtgctcaag
cccgccgccgaaacaccgctgaccgcaaacgctttggcggaggtgttcgccgaggtgggc
ctgcccgagggggtgttgtcggtagtgccgggagggattgagaccggtcaggcgctgacg
tctaacccggacatcgacatgtttaccttcaccggcagctcggccgtcggccgagaggtc
ggcaggcgtgccgctgagatgctcaagccgtgcaccttagaactcggcggcaagtcggcg
gccatcattctcgaggacgtcgacctggccgcagctattccgatgatggtgttctccggc
gtcatgaacgccggacagggctgcgtcaaccagacccgcattctggctccgcgctcccgg
tacgacgaaatcgtggctgcggtaactaatttcgtaacggctctcccggtgggcccgccg
tcggacccggcagctcagatcgggccgctgatctcggagaagcagcggactcgcgttgaa
ggctacatcgccaagggcatcgaggagggcgctcggttggtgtgcggcggcggccgtccc
gagggcttggacaacggcttctttatccaacccaccgtattcgccgatgtcgacaacaag
atgaccatcgcacaggaggagatcttcgggccggtgctggccatcattccttatgacacc
gaggaggacgcgatcgcgatcgccaacgattcagtgtatgggctggcgggcagcgtgtgg
accaccgacgtgcccaaaggcatcaagatctcgcagcagatccgcaccgggacatacgga
atcaactggtacgccttcgatcccggctcacccttcggcggctacaagaactccggaatc
ggccgcgagaacgggcccgagggtgtcgaacacttcacccagcaaaagagtgtcctgctg
ccgatgggctacaccgtcgcgtag

DBGET integrated database retrieval system